Isolation and Molecular Identification of Potential Probiotic Yeast Strains Found in Malaysian Kefir Drinks Samples
Kefir drink is a product from the fermentation process of milk using symbiotic mixture of bacteria and yeast consortium. Saccharomyces and lactobacillus are the major genera found in the kefir drink. The present work involves the isolation and identification of potential probiotic yeast strains in t...
| Main Authors: | , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
2019
|
| Subjects: | |
| Online Access: | http://umpir.ump.edu.my/id/eprint/26634/1/akmalazhar2019%20%281%29.pdf |
| _version_ | 1825813014200188928 |
|---|---|
| author | Mohd Akmal, Azhar Dr. Mimi Sakinah, Abdul Munaim |
| author_facet | Mohd Akmal, Azhar Dr. Mimi Sakinah, Abdul Munaim |
| author_sort | Mohd Akmal, Azhar |
| collection | UMP |
| description | Kefir drink is a product from the fermentation process of milk using symbiotic mixture of bacteria and yeast consortium. Saccharomyces and lactobacillus are the major genera found in the kefir drink. The present work involves the isolation and identification of potential probiotic yeast strains in the kefir drink samples from Malaysia. The molecular identification was done by PCR using ITS1 and ITS4 amplified regions. Nine different yeast strains were isolated, and the strains were successfully identified based on the sequence analysis. Saccharomyces and Kodamaea were found to be the major population in the kefir drink samples. Lastly, kefir milk is one of the excellent sources of probiotic yeast strains and could be used as a new yeast probiotic formulation or in food supplements. Moreover, the amplification of ITS region can be used as a useful method to identified yeast strains. |
| first_indexed | 2024-03-06T12:37:43Z |
| format | Article |
| id | UMPir26634 |
| institution | Universiti Malaysia Pahang |
| language | English |
| last_indexed | 2024-03-06T12:37:43Z |
| publishDate | 2019 |
| record_format | dspace |
| spelling | UMPir266342019-12-05T06:23:43Z http://umpir.ump.edu.my/id/eprint/26634/ Isolation and Molecular Identification of Potential Probiotic Yeast Strains Found in Malaysian Kefir Drinks Samples Mohd Akmal, Azhar Dr. Mimi Sakinah, Abdul Munaim T Technology (General) TP Chemical technology Kefir drink is a product from the fermentation process of milk using symbiotic mixture of bacteria and yeast consortium. Saccharomyces and lactobacillus are the major genera found in the kefir drink. The present work involves the isolation and identification of potential probiotic yeast strains in the kefir drink samples from Malaysia. The molecular identification was done by PCR using ITS1 and ITS4 amplified regions. Nine different yeast strains were isolated, and the strains were successfully identified based on the sequence analysis. Saccharomyces and Kodamaea were found to be the major population in the kefir drink samples. Lastly, kefir milk is one of the excellent sources of probiotic yeast strains and could be used as a new yeast probiotic formulation or in food supplements. Moreover, the amplification of ITS region can be used as a useful method to identified yeast strains. 2019-10-04 Article PeerReviewed pdf en http://umpir.ump.edu.my/id/eprint/26634/1/akmalazhar2019%20%281%29.pdf Mohd Akmal, Azhar and Dr. Mimi Sakinah, Abdul Munaim (2019) Isolation and Molecular Identification of Potential Probiotic Yeast Strains Found in Malaysian Kefir Drinks Samples. International Journal of Pharma Medicine and Biological Sciences, 8 (4). pp. 128-131. ISSN 2278-5221. (Published) http://International Journal of Pharma Medicine and Biologica Sciences http://10.18178/ijpmbs.8.4.128-131 |
| spellingShingle | T Technology (General) TP Chemical technology Mohd Akmal, Azhar Dr. Mimi Sakinah, Abdul Munaim Isolation and Molecular Identification of Potential Probiotic Yeast Strains Found in Malaysian Kefir Drinks Samples |
| title | Isolation and Molecular Identification of Potential Probiotic Yeast Strains Found in Malaysian Kefir Drinks Samples |
| title_full | Isolation and Molecular Identification of Potential Probiotic Yeast Strains Found in Malaysian Kefir Drinks Samples |
| title_fullStr | Isolation and Molecular Identification of Potential Probiotic Yeast Strains Found in Malaysian Kefir Drinks Samples |
| title_full_unstemmed | Isolation and Molecular Identification of Potential Probiotic Yeast Strains Found in Malaysian Kefir Drinks Samples |
| title_short | Isolation and Molecular Identification of Potential Probiotic Yeast Strains Found in Malaysian Kefir Drinks Samples |
| title_sort | isolation and molecular identification of potential probiotic yeast strains found in malaysian kefir drinks samples |
| topic | T Technology (General) TP Chemical technology |
| url | http://umpir.ump.edu.my/id/eprint/26634/1/akmalazhar2019%20%281%29.pdf |
| work_keys_str_mv | AT mohdakmalazhar isolationandmolecularidentificationofpotentialprobioticyeaststrainsfoundinmalaysiankefirdrinkssamples AT drmimisakinahabdulmunaim isolationandmolecularidentificationofpotentialprobioticyeaststrainsfoundinmalaysiankefirdrinkssamples |