Activation of PI3K/AKT and ERK MAPK signal pathways is required for the induction of lytic cycle replication of Kaposi's Sarcoma-associated herpesvirus by herpes simplex virus type 1
<p>Abstract</p> <p>Background</p> <p>Kaposi's sarcoma-associated herpesvirus (KSHV) is causally linked to several acquired immunodeficiency syndrome-related malignancies, including Kaposi's sarcoma (KS), primary effusion lymphoma (PEL) and a subset of multicen...
Main Authors: | , , , , , , , , |
---|---|
Format: | Article |
Language: | English |
Published: |
BMC
2011-10-01
|
Series: | BMC Microbiology |
Online Access: | http://www.biomedcentral.com/1471-2180/11/240 |
_version_ | 1831557987960881152 |
---|---|
author | Lv Zhigang Yan Qin Ma Xinting Fan Weifei Feng Ninghan Qin Di Zeng Yi Zhu Jianzhong Lu Chun |
author_facet | Lv Zhigang Yan Qin Ma Xinting Fan Weifei Feng Ninghan Qin Di Zeng Yi Zhu Jianzhong Lu Chun |
author_sort | Lv Zhigang |
collection | DOAJ |
description | <p>Abstract</p> <p>Background</p> <p>Kaposi's sarcoma-associated herpesvirus (KSHV) is causally linked to several acquired immunodeficiency syndrome-related malignancies, including Kaposi's sarcoma (KS), primary effusion lymphoma (PEL) and a subset of multicentric Castleman's disease. Regulation of viral lytic replication is critical to the initiation and progression of KS. Recently, we reported that herpes simplex virus type 1 (HSV-1) was an important cofactor that activated lytic cycle replication of KSHV. Here, we further investigated the possible signal pathways involved in HSV-1-induced reactivation of KSHV.</p> <p>Results</p> <p>By transfecting a series of dominant negative mutants and protein expressing constructs and using pharmacologic inhibitors, we found that either Janus kinase 1 (JAK1)/signal transducer and activator of transcription 3 (STAT3) or JAK1/STAT6 signaling failed to regulate HSV-1-induced KSHV replication. However, HSV-1 infection of BCBL-1 cells activated phosphatidylinositol 3-kinase (PI3K)/protein kinase B (PKB, also called AKT) pathway and inactivated phosphatase and tensin homologue deleted on chromosome ten (PTEN) and glycogen synthase kinase-3β (GSK-3β). PTEN/PI3K/AKT/GSK-3β pathway was found to be involved in HSV-1-induced KSHV reactivation. Additionally, extracellular signal-regulated protein kinase (ERK) mitogen-activated protein kinase (MAPK) pathway also partially contributed to HSV-1-induced KSHV replication.</p> <p>Conclusions</p> <p>HSV-1 infection stimulated PI3K/AKT and ERK MAPK signaling pathways that in turn contributed to KSHV reactivation, which provided further insights into the molecular mechanism controlling KSHV lytic replication, particularly in the context of HSV-1 and KSHV co-infection.</p> |
first_indexed | 2024-12-17T05:01:30Z |
format | Article |
id | doaj.art-028816c8b6e64c0aa26bca027879d7cf |
institution | Directory Open Access Journal |
issn | 1471-2180 |
language | English |
last_indexed | 2024-12-17T05:01:30Z |
publishDate | 2011-10-01 |
publisher | BMC |
record_format | Article |
series | BMC Microbiology |
spelling | doaj.art-028816c8b6e64c0aa26bca027879d7cf2022-12-21T22:02:32ZengBMCBMC Microbiology1471-21802011-10-0111124010.1186/1471-2180-11-240Activation of PI3K/AKT and ERK MAPK signal pathways is required for the induction of lytic cycle replication of Kaposi's Sarcoma-associated herpesvirus by herpes simplex virus type 1Lv ZhigangYan QinMa XintingFan WeifeiFeng NinghanQin DiZeng YiZhu JianzhongLu Chun<p>Abstract</p> <p>Background</p> <p>Kaposi's sarcoma-associated herpesvirus (KSHV) is causally linked to several acquired immunodeficiency syndrome-related malignancies, including Kaposi's sarcoma (KS), primary effusion lymphoma (PEL) and a subset of multicentric Castleman's disease. Regulation of viral lytic replication is critical to the initiation and progression of KS. Recently, we reported that herpes simplex virus type 1 (HSV-1) was an important cofactor that activated lytic cycle replication of KSHV. Here, we further investigated the possible signal pathways involved in HSV-1-induced reactivation of KSHV.</p> <p>Results</p> <p>By transfecting a series of dominant negative mutants and protein expressing constructs and using pharmacologic inhibitors, we found that either Janus kinase 1 (JAK1)/signal transducer and activator of transcription 3 (STAT3) or JAK1/STAT6 signaling failed to regulate HSV-1-induced KSHV replication. However, HSV-1 infection of BCBL-1 cells activated phosphatidylinositol 3-kinase (PI3K)/protein kinase B (PKB, also called AKT) pathway and inactivated phosphatase and tensin homologue deleted on chromosome ten (PTEN) and glycogen synthase kinase-3β (GSK-3β). PTEN/PI3K/AKT/GSK-3β pathway was found to be involved in HSV-1-induced KSHV reactivation. Additionally, extracellular signal-regulated protein kinase (ERK) mitogen-activated protein kinase (MAPK) pathway also partially contributed to HSV-1-induced KSHV replication.</p> <p>Conclusions</p> <p>HSV-1 infection stimulated PI3K/AKT and ERK MAPK signaling pathways that in turn contributed to KSHV reactivation, which provided further insights into the molecular mechanism controlling KSHV lytic replication, particularly in the context of HSV-1 and KSHV co-infection.</p>http://www.biomedcentral.com/1471-2180/11/240 |
spellingShingle | Lv Zhigang Yan Qin Ma Xinting Fan Weifei Feng Ninghan Qin Di Zeng Yi Zhu Jianzhong Lu Chun Activation of PI3K/AKT and ERK MAPK signal pathways is required for the induction of lytic cycle replication of Kaposi's Sarcoma-associated herpesvirus by herpes simplex virus type 1 BMC Microbiology |
title | Activation of PI3K/AKT and ERK MAPK signal pathways is required for the induction of lytic cycle replication of Kaposi's Sarcoma-associated herpesvirus by herpes simplex virus type 1 |
title_full | Activation of PI3K/AKT and ERK MAPK signal pathways is required for the induction of lytic cycle replication of Kaposi's Sarcoma-associated herpesvirus by herpes simplex virus type 1 |
title_fullStr | Activation of PI3K/AKT and ERK MAPK signal pathways is required for the induction of lytic cycle replication of Kaposi's Sarcoma-associated herpesvirus by herpes simplex virus type 1 |
title_full_unstemmed | Activation of PI3K/AKT and ERK MAPK signal pathways is required for the induction of lytic cycle replication of Kaposi's Sarcoma-associated herpesvirus by herpes simplex virus type 1 |
title_short | Activation of PI3K/AKT and ERK MAPK signal pathways is required for the induction of lytic cycle replication of Kaposi's Sarcoma-associated herpesvirus by herpes simplex virus type 1 |
title_sort | activation of pi3k akt and erk mapk signal pathways is required for the induction of lytic cycle replication of kaposi s sarcoma associated herpesvirus by herpes simplex virus type 1 |
url | http://www.biomedcentral.com/1471-2180/11/240 |
work_keys_str_mv | AT lvzhigang activationofpi3kaktanderkmapksignalpathwaysisrequiredfortheinductionoflyticcyclereplicationofkaposissarcomaassociatedherpesvirusbyherpessimplexvirustype1 AT yanqin activationofpi3kaktanderkmapksignalpathwaysisrequiredfortheinductionoflyticcyclereplicationofkaposissarcomaassociatedherpesvirusbyherpessimplexvirustype1 AT maxinting activationofpi3kaktanderkmapksignalpathwaysisrequiredfortheinductionoflyticcyclereplicationofkaposissarcomaassociatedherpesvirusbyherpessimplexvirustype1 AT fanweifei activationofpi3kaktanderkmapksignalpathwaysisrequiredfortheinductionoflyticcyclereplicationofkaposissarcomaassociatedherpesvirusbyherpessimplexvirustype1 AT fengninghan activationofpi3kaktanderkmapksignalpathwaysisrequiredfortheinductionoflyticcyclereplicationofkaposissarcomaassociatedherpesvirusbyherpessimplexvirustype1 AT qindi activationofpi3kaktanderkmapksignalpathwaysisrequiredfortheinductionoflyticcyclereplicationofkaposissarcomaassociatedherpesvirusbyherpessimplexvirustype1 AT zengyi activationofpi3kaktanderkmapksignalpathwaysisrequiredfortheinductionoflyticcyclereplicationofkaposissarcomaassociatedherpesvirusbyherpessimplexvirustype1 AT zhujianzhong activationofpi3kaktanderkmapksignalpathwaysisrequiredfortheinductionoflyticcyclereplicationofkaposissarcomaassociatedherpesvirusbyherpessimplexvirustype1 AT luchun activationofpi3kaktanderkmapksignalpathwaysisrequiredfortheinductionoflyticcyclereplicationofkaposissarcomaassociatedherpesvirusbyherpessimplexvirustype1 |