On line prediction of roll grinding chatter based on EMD component and wavelet packet energy entropy
To address the issue of partial feature loss in the single processing method within the time-frequency domain for roll grinding chatter, a combined time-frequency domain method is proposed to process signal feature. An intelligent algorithm is used to achieve online prediction of roll grinding chatt...
| Main Authors: | , , , , |
|---|---|
| Format: | Article |
| Language: | zho |
| Published: |
Zhengzhou Research Institute for Abrasives & Grinding Co., Ltd.
2024-02-01
|
| Series: | Jin'gangshi yu moliao moju gongcheng |
| Subjects: | |
| Online Access: | http://www.jgszz.cn/article/doi/10.13394/j.cnki.jgszz.2022.0198 |
| _version_ | 1827314589722738688 |
|---|---|
| author | Huanhuan ZHU Yulun CHI Mengmeng ZHANG Li XIONG Xiaoang YING |
| author_facet | Huanhuan ZHU Yulun CHI Mengmeng ZHANG Li XIONG Xiaoang YING |
| author_sort | Huanhuan ZHU |
| collection | DOAJ |
| description | To address the issue of partial feature loss in the single processing method within the time-frequency domain for roll grinding chatter, a combined time-frequency domain method is proposed to process signal feature. An intelligent algorithm is used to achieve online prediction of roll grinding chatter. Firstly, the empirical mode decomposition (EMD) method is utilized to decompose the vibration sensor signals, extrating the intrinsic mode function (IMF) while removing "spurious components" to calculate time domain characteristics associated with roll grinding chatter. Then, wavelet packet energy entropy is used to solve the frequency band node energy entropy values of acoustic emission sensor signals, obtaining frequency domain features characterizing the roll grinding chatter. Finally, the time-frequency domain features after dimension reduction is substituted into the intelligent algorithm model for online prediction of the roller grinding process. The results show that the the LV-SVM model achieves an average classification accuracy of 92.75%, with an average response time of 0.776 5 s. This verifies the validity of EMD and LV-SVM based on wavelet packet energy entropy in the time-frequency domain for online prediction of roller grinding chatter. |
| first_indexed | 2024-04-24T22:38:38Z |
| format | Article |
| id | doaj.art-0980d95864dd4263937113865831d657 |
| institution | Directory Open Access Journal |
| issn | 1006-852X |
| language | zho |
| last_indexed | 2024-04-24T22:38:38Z |
| publishDate | 2024-02-01 |
| publisher | Zhengzhou Research Institute for Abrasives & Grinding Co., Ltd. |
| record_format | Article |
| series | Jin'gangshi yu moliao moju gongcheng |
| spelling | doaj.art-0980d95864dd4263937113865831d6572024-03-19T06:49:40ZzhoZhengzhou Research Institute for Abrasives & Grinding Co., Ltd.Jin'gangshi yu moliao moju gongcheng1006-852X2024-02-01441738410.13394/j.cnki.jgszz.2022.01982022-0198--ZHUHUANHUANOn line prediction of roll grinding chatter based on EMD component and wavelet packet energy entropyHuanhuan ZHU0Yulun CHI1Mengmeng ZHANG2Li XIONG3Xiaoang YING4Department of Manufacturing Shanghai Technician School, Shanghai 200437, ChinaSchool of Mechanical Engineering, University of Shanghai for Science and Technology, Shanghai 200093, ChinaDepartment of Manufacturing Shanghai Technician School, Shanghai 200437, ChinaSchool of Mechanical Engineering, University of Shanghai for Science and Technology, Shanghai 200093, ChinaSchool of Mechanical Engineering, University of Shanghai for Science and Technology, Shanghai 200093, ChinaTo address the issue of partial feature loss in the single processing method within the time-frequency domain for roll grinding chatter, a combined time-frequency domain method is proposed to process signal feature. An intelligent algorithm is used to achieve online prediction of roll grinding chatter. Firstly, the empirical mode decomposition (EMD) method is utilized to decompose the vibration sensor signals, extrating the intrinsic mode function (IMF) while removing "spurious components" to calculate time domain characteristics associated with roll grinding chatter. Then, wavelet packet energy entropy is used to solve the frequency band node energy entropy values of acoustic emission sensor signals, obtaining frequency domain features characterizing the roll grinding chatter. Finally, the time-frequency domain features after dimension reduction is substituted into the intelligent algorithm model for online prediction of the roller grinding process. The results show that the the LV-SVM model achieves an average classification accuracy of 92.75%, with an average response time of 0.776 5 s. This verifies the validity of EMD and LV-SVM based on wavelet packet energy entropy in the time-frequency domain for online prediction of roller grinding chatter.http://www.jgszz.cn/article/doi/10.13394/j.cnki.jgszz.2022.0198roll grinding chatteremd decompositionintrinsic mode function (imf)wavelet energy entropyleast squares support vector machine (ls-svm) |
| spellingShingle | Huanhuan ZHU Yulun CHI Mengmeng ZHANG Li XIONG Xiaoang YING On line prediction of roll grinding chatter based on EMD component and wavelet packet energy entropy Jin'gangshi yu moliao moju gongcheng roll grinding chatter emd decomposition intrinsic mode function (imf) wavelet energy entropy least squares support vector machine (ls-svm) |
| title | On line prediction of roll grinding chatter based on EMD component and wavelet packet energy entropy |
| title_full | On line prediction of roll grinding chatter based on EMD component and wavelet packet energy entropy |
| title_fullStr | On line prediction of roll grinding chatter based on EMD component and wavelet packet energy entropy |
| title_full_unstemmed | On line prediction of roll grinding chatter based on EMD component and wavelet packet energy entropy |
| title_short | On line prediction of roll grinding chatter based on EMD component and wavelet packet energy entropy |
| title_sort | on line prediction of roll grinding chatter based on emd component and wavelet packet energy entropy |
| topic | roll grinding chatter emd decomposition intrinsic mode function (imf) wavelet energy entropy least squares support vector machine (ls-svm) |
| url | http://www.jgszz.cn/article/doi/10.13394/j.cnki.jgszz.2022.0198 |
| work_keys_str_mv | AT huanhuanzhu onlinepredictionofrollgrindingchatterbasedonemdcomponentandwaveletpacketenergyentropy AT yulunchi onlinepredictionofrollgrindingchatterbasedonemdcomponentandwaveletpacketenergyentropy AT mengmengzhang onlinepredictionofrollgrindingchatterbasedonemdcomponentandwaveletpacketenergyentropy AT lixiong onlinepredictionofrollgrindingchatterbasedonemdcomponentandwaveletpacketenergyentropy AT xiaoangying onlinepredictionofrollgrindingchatterbasedonemdcomponentandwaveletpacketenergyentropy |