Presepsin is a novel highly effective sepsis marker (Review)
In this review the most effective markers of septic process like Procalcitonin, C-reactive protein, and cytokines compared to the new marker – Presepsin (PSP) are analyzed. At sepsis initiation, PSP increases 30 to 60 minutes after the onset of systemic infection. PSP levels at admission to the h...
| Main Authors: | , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Zaporizhia Medical Academy of Post-Graduate Education Ministry of Health of Ukraine
2020-04-01
|
| Series: | Сучасні медичні технології |
| Online Access: | https://zmapo-journal.com/index.php/journal/article/view/67 |
| _version_ | 1811343790977318912 |
|---|---|
| author | S. D. Shapoval I. L. Savon L. V. Vasylevska M. M. Sofilkanych |
| author_facet | S. D. Shapoval I. L. Savon L. V. Vasylevska M. M. Sofilkanych |
| author_sort | S. D. Shapoval |
| collection | DOAJ |
| description | In this review the most effective markers of septic process like Procalcitonin, C-reactive protein, and cytokines compared to the new marker – Presepsin (PSP) are analyzed.
At sepsis initiation, PSP increases 30 to 60 minutes after the onset of systemic infection. PSP levels at admission to the hospital predict the risk of adverse and adverse effects that other markers used for the diagnosis of sepsis do not have. |
| first_indexed | 2024-04-13T19:36:11Z |
| format | Article |
| id | doaj.art-0cae49a9a44d4e67817749cf57163305 |
| institution | Directory Open Access Journal |
| issn | 2072-9367 |
| language | English |
| last_indexed | 2024-04-13T19:36:11Z |
| publishDate | 2020-04-01 |
| publisher | Zaporizhia Medical Academy of Post-Graduate Education Ministry of Health of Ukraine |
| record_format | Article |
| series | Сучасні медичні технології |
| spelling | doaj.art-0cae49a9a44d4e67817749cf571633052022-12-22T02:33:01ZengZaporizhia Medical Academy of Post-Graduate Education Ministry of Health of UkraineСучасні медичні технології2072-93672020-04-011(44)848710.34287/MMT.1(44).2020.1367Presepsin is a novel highly effective sepsis marker (Review)S. D. Shapoval0I. L. Savon1L. V. Vasylevska2M. M. Sofilkanych3Sepsis Institute of State Institution «Zaporizhia Medical Academy of post-graduate education Ministry of Health of Ukraine»Sepsis Institute of State Institution «Zaporizhia Medical Academy of post-graduate education Ministry of Health of Ukraine»Sepsis Institute of State Institution «Zaporizhia Medical Academy of post-graduate education Ministry of Health of Ukraine»Sepsis Institute of State Institution «Zaporizhia Medical Academy of post-graduate education Ministry of Health of Ukraine»In this review the most effective markers of septic process like Procalcitonin, C-reactive protein, and cytokines compared to the new marker – Presepsin (PSP) are analyzed. At sepsis initiation, PSP increases 30 to 60 minutes after the onset of systemic infection. PSP levels at admission to the hospital predict the risk of adverse and adverse effects that other markers used for the diagnosis of sepsis do not have.https://zmapo-journal.com/index.php/journal/article/view/67 |
| spellingShingle | S. D. Shapoval I. L. Savon L. V. Vasylevska M. M. Sofilkanych Presepsin is a novel highly effective sepsis marker (Review) Сучасні медичні технології |
| title | Presepsin is a novel highly effective sepsis marker (Review) |
| title_full | Presepsin is a novel highly effective sepsis marker (Review) |
| title_fullStr | Presepsin is a novel highly effective sepsis marker (Review) |
| title_full_unstemmed | Presepsin is a novel highly effective sepsis marker (Review) |
| title_short | Presepsin is a novel highly effective sepsis marker (Review) |
| title_sort | presepsin is a novel highly effective sepsis marker review |
| url | https://zmapo-journal.com/index.php/journal/article/view/67 |
| work_keys_str_mv | AT sdshapoval presepsinisanovelhighlyeffectivesepsismarkerreview AT ilsavon presepsinisanovelhighlyeffectivesepsismarkerreview AT lvvasylevska presepsinisanovelhighlyeffectivesepsismarkerreview AT mmsofilkanych presepsinisanovelhighlyeffectivesepsismarkerreview |