Selaginellatamariscina attenuates metastasis via Akt pathways in oral cancer cells.
BACKGROUND: Crude extracts of Selaginellatamariscina, an oriental medicinal herb, have been evidenced to treat several human diseases. This study investigated the mechanisms by which Selaginellatamariscina inhibits the invasiveness of human oral squamous-cell carcinoma (OSCC) HSC-3 cells. METHODOLOG...
| Main Authors: | , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Public Library of Science (PLoS)
2013-01-01
|
| Series: | PLoS ONE |
| Online Access: | http://europepmc.org/articles/PMC3683067?pdf=render |
| _version_ | 1818967750737920000 |
|---|---|
| author | Jia-Sin Yang Chiao-Wen Lin Chung-Han Hsin Ming-Ju Hsieh Yu-Chao Chang |
| author_facet | Jia-Sin Yang Chiao-Wen Lin Chung-Han Hsin Ming-Ju Hsieh Yu-Chao Chang |
| author_sort | Jia-Sin Yang |
| collection | DOAJ |
| description | BACKGROUND: Crude extracts of Selaginellatamariscina, an oriental medicinal herb, have been evidenced to treat several human diseases. This study investigated the mechanisms by which Selaginellatamariscina inhibits the invasiveness of human oral squamous-cell carcinoma (OSCC) HSC-3 cells. METHODOLOGY/PRINCIPAL FINDINGS: Herein, we demonstrate that Selaginellatamariscina attenuated HSC-3 cell migration and invasion in a dose-dependent manner. The anti-metastatic activities of Selaginellatamariscina occurred at least partially because of the down-regulation of matrix metalloproteinases (MMP)-2 and MMP-9 gelatinase activity and the down-regulation of protein expression. The expression and function of both MMP-2 and MMP-9 were regulated by Selaginellatamariscina at a transcriptional level, as shown by quantitative real-time PCR and reporter assays. Chromatin immunoprecipitation (ChIP) data further indicated that binding of the cAMP response element-binding (CREB) protein and activating protein-1 (AP-1) to the MMP-2 promoter diminished at the highest dosage level of Selaginellatamariscina. The DNA-binding activity of specificity protein 1 (SP-1) to the MMP-9 promoter was also suppressed at the same concentration. Selaginellatamariscina did not affect the mitogen-activated protein kinase signaling pathway, but did inhibit the effects of gelatinase by reducing the activation of serine-threonine kinase Akt. CONCLUSIONS: These results demonstrate that Selaginellatamariscina may be a potent adjuvant therapeutic agent in the prevention of oral cancer. |
| first_indexed | 2024-12-20T13:53:46Z |
| format | Article |
| id | doaj.art-0e98446d7a50423ca7771660efe0c040 |
| institution | Directory Open Access Journal |
| issn | 1932-6203 |
| language | English |
| last_indexed | 2024-12-20T13:53:46Z |
| publishDate | 2013-01-01 |
| publisher | Public Library of Science (PLoS) |
| record_format | Article |
| series | PLoS ONE |
| spelling | doaj.art-0e98446d7a50423ca7771660efe0c0402022-12-21T19:38:28ZengPublic Library of Science (PLoS)PLoS ONE1932-62032013-01-0186e6803510.1371/journal.pone.0068035Selaginellatamariscina attenuates metastasis via Akt pathways in oral cancer cells.Jia-Sin YangChiao-Wen LinChung-Han HsinMing-Ju HsiehYu-Chao ChangBACKGROUND: Crude extracts of Selaginellatamariscina, an oriental medicinal herb, have been evidenced to treat several human diseases. This study investigated the mechanisms by which Selaginellatamariscina inhibits the invasiveness of human oral squamous-cell carcinoma (OSCC) HSC-3 cells. METHODOLOGY/PRINCIPAL FINDINGS: Herein, we demonstrate that Selaginellatamariscina attenuated HSC-3 cell migration and invasion in a dose-dependent manner. The anti-metastatic activities of Selaginellatamariscina occurred at least partially because of the down-regulation of matrix metalloproteinases (MMP)-2 and MMP-9 gelatinase activity and the down-regulation of protein expression. The expression and function of both MMP-2 and MMP-9 were regulated by Selaginellatamariscina at a transcriptional level, as shown by quantitative real-time PCR and reporter assays. Chromatin immunoprecipitation (ChIP) data further indicated that binding of the cAMP response element-binding (CREB) protein and activating protein-1 (AP-1) to the MMP-2 promoter diminished at the highest dosage level of Selaginellatamariscina. The DNA-binding activity of specificity protein 1 (SP-1) to the MMP-9 promoter was also suppressed at the same concentration. Selaginellatamariscina did not affect the mitogen-activated protein kinase signaling pathway, but did inhibit the effects of gelatinase by reducing the activation of serine-threonine kinase Akt. CONCLUSIONS: These results demonstrate that Selaginellatamariscina may be a potent adjuvant therapeutic agent in the prevention of oral cancer.http://europepmc.org/articles/PMC3683067?pdf=render |
| spellingShingle | Jia-Sin Yang Chiao-Wen Lin Chung-Han Hsin Ming-Ju Hsieh Yu-Chao Chang Selaginellatamariscina attenuates metastasis via Akt pathways in oral cancer cells. PLoS ONE |
| title | Selaginellatamariscina attenuates metastasis via Akt pathways in oral cancer cells. |
| title_full | Selaginellatamariscina attenuates metastasis via Akt pathways in oral cancer cells. |
| title_fullStr | Selaginellatamariscina attenuates metastasis via Akt pathways in oral cancer cells. |
| title_full_unstemmed | Selaginellatamariscina attenuates metastasis via Akt pathways in oral cancer cells. |
| title_short | Selaginellatamariscina attenuates metastasis via Akt pathways in oral cancer cells. |
| title_sort | selaginellatamariscina attenuates metastasis via akt pathways in oral cancer cells |
| url | http://europepmc.org/articles/PMC3683067?pdf=render |
| work_keys_str_mv | AT jiasinyang selaginellatamariscinaattenuatesmetastasisviaaktpathwaysinoralcancercells AT chiaowenlin selaginellatamariscinaattenuatesmetastasisviaaktpathwaysinoralcancercells AT chunghanhsin selaginellatamariscinaattenuatesmetastasisviaaktpathwaysinoralcancercells AT mingjuhsieh selaginellatamariscinaattenuatesmetastasisviaaktpathwaysinoralcancercells AT yuchaochang selaginellatamariscinaattenuatesmetastasisviaaktpathwaysinoralcancercells |