The complete mitochondrial genome of Megaderma lyra (Indian false vampire)
The Indian false vampire (Megaderma lyra), known as the greater false vampire bat, the Indian false vampire bat, and the greater false-vampire, is typical echolocation mammals. It has been listed in the IUCN Red List of threatened species and included in the Red Book of Endangered Animals in China....
| Main Authors: | , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Taylor & Francis Group
2018-01-01
|
| Series: | Mitochondrial DNA. Part B. Resources |
| Subjects: | |
| Online Access: | http://dx.doi.org/10.1080/23802359.2018.1443851 |
| _version_ | 1797640661052162048 |
|---|---|
| author | Mengjia Liu Yanhong Lan Yi Cao |
| author_facet | Mengjia Liu Yanhong Lan Yi Cao |
| author_sort | Mengjia Liu |
| collection | DOAJ |
| description | The Indian false vampire (Megaderma lyra), known as the greater false vampire bat, the Indian false vampire bat, and the greater false-vampire, is typical echolocation mammals. It has been listed in the IUCN Red List of threatened species and included in the Red Book of Endangered Animals in China. Herein, we described 17,055 bp of M. lyra mtDNA that includes 13 protein-coding genes (PGCs), two rRNA genes (12S rRNA and 16S rRNA), 22 transfer RNA (tRNA) genes, and one control region (D-loop). The complete mitochondrial genome sequence will provide new molecular biology information to further understand the genetic diversity of the M. lyra and to protect this population. |
| first_indexed | 2024-03-11T13:35:03Z |
| format | Article |
| id | doaj.art-10314724d32c4172bc0295abbbec5c9e |
| institution | Directory Open Access Journal |
| issn | 2380-2359 |
| language | English |
| last_indexed | 2024-03-11T13:35:03Z |
| publishDate | 2018-01-01 |
| publisher | Taylor & Francis Group |
| record_format | Article |
| series | Mitochondrial DNA. Part B. Resources |
| spelling | doaj.art-10314724d32c4172bc0295abbbec5c9e2023-11-02T15:57:22ZengTaylor & Francis GroupMitochondrial DNA. Part B. Resources2380-23592018-01-013129930010.1080/23802359.2018.14438511443851The complete mitochondrial genome of Megaderma lyra (Indian false vampire)Mengjia Liu0Yanhong Lan1Yi Cao2Sichuan UniversitySichuan UniversitySichuan UniversityThe Indian false vampire (Megaderma lyra), known as the greater false vampire bat, the Indian false vampire bat, and the greater false-vampire, is typical echolocation mammals. It has been listed in the IUCN Red List of threatened species and included in the Red Book of Endangered Animals in China. Herein, we described 17,055 bp of M. lyra mtDNA that includes 13 protein-coding genes (PGCs), two rRNA genes (12S rRNA and 16S rRNA), 22 transfer RNA (tRNA) genes, and one control region (D-loop). The complete mitochondrial genome sequence will provide new molecular biology information to further understand the genetic diversity of the M. lyra and to protect this population.http://dx.doi.org/10.1080/23802359.2018.1443851megaderma lyramitochondrial genome; protein-coding genes |
| spellingShingle | Mengjia Liu Yanhong Lan Yi Cao The complete mitochondrial genome of Megaderma lyra (Indian false vampire) Mitochondrial DNA. Part B. Resources megaderma lyra mitochondrial genome; protein-coding genes |
| title | The complete mitochondrial genome of Megaderma lyra (Indian false vampire) |
| title_full | The complete mitochondrial genome of Megaderma lyra (Indian false vampire) |
| title_fullStr | The complete mitochondrial genome of Megaderma lyra (Indian false vampire) |
| title_full_unstemmed | The complete mitochondrial genome of Megaderma lyra (Indian false vampire) |
| title_short | The complete mitochondrial genome of Megaderma lyra (Indian false vampire) |
| title_sort | complete mitochondrial genome of megaderma lyra indian false vampire |
| topic | megaderma lyra mitochondrial genome; protein-coding genes |
| url | http://dx.doi.org/10.1080/23802359.2018.1443851 |
| work_keys_str_mv | AT mengjialiu thecompletemitochondrialgenomeofmegadermalyraindianfalsevampire AT yanhonglan thecompletemitochondrialgenomeofmegadermalyraindianfalsevampire AT yicao thecompletemitochondrialgenomeofmegadermalyraindianfalsevampire AT mengjialiu completemitochondrialgenomeofmegadermalyraindianfalsevampire AT yanhonglan completemitochondrialgenomeofmegadermalyraindianfalsevampire AT yicao completemitochondrialgenomeofmegadermalyraindianfalsevampire |