Isolation and characterization of β-defensin-like protein 1 from epidermal mucus of fungal infected fish (Cyprinus carpio) and assessment of its antimicrobial potencies
Fish epidermis is rich in different pharmacologically active substances, most of which play a crucial role in immunity. In the current study, β-defensin-like protein 1 with high in vitro antimicrobial activity was isolated and characterized from crude epidermal mucus extract of common carp, Cyprinus...
| Main Authors: | , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Elsevier
2022-04-01
|
| Series: | Aquaculture Reports |
| Subjects: | |
| Online Access: | http://www.sciencedirect.com/science/article/pii/S2352513422000527 |
| _version_ | 1818289477021335552 |
|---|---|
| author | Uzma Shabir Jehangir Shafi Dar Aashaq Hussain Bhat Bashir Ahmad Ganai Imtiaz Ahmad Khan |
| author_facet | Uzma Shabir Jehangir Shafi Dar Aashaq Hussain Bhat Bashir Ahmad Ganai Imtiaz Ahmad Khan |
| author_sort | Uzma Shabir |
| collection | DOAJ |
| description | Fish epidermis is rich in different pharmacologically active substances, most of which play a crucial role in immunity. In the current study, β-defensin-like protein 1 with high in vitro antimicrobial activity was isolated and characterized from crude epidermal mucus extract of common carp, Cyprinus carpio L. The crude mucus was screened for antimicrobial activity against five bacterial and four fungal pathogens. Crude mucus exhibited varied antimicrobial activity against all the used pathogens. Sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) of crude mucus extract revealed multiple prominent bands with molecular weights corresponding to 6.9 kDa, 14.5 kDa, 24 kDa, 27 kDa and 48 kDa. Using Sephadex G-50 gel filtration liquid chromatography in conjunction with mass spectroscopy (LC/MS), a single peak with a molecular weight of 6908 Da was isolated and characterized. This peptide showed potent antimicrobial activity against all the five bacterial and four fungal strains used. Leclercia adecarboxylata and Enterobacter kobei were most susceptible with minimum inhibition concentration (MIC) value of 0.017 mg/mL, while Aeromonas sobria was least susceptible with an MIC of 2.24 mg/mL. Among the fungal pathogens, Candida glabrata was most susceptible with MIC value of 0.14 mg/mL, while Aspergillus sp. was least susceptible with MIC value of 4.48 mg/mL. The activity was further confirmed by the time kill assay. The antimicrobial peptide sequence determined from mass spectra was “PQSILVLLVLVVLALHCKENEAVSFPWSCASLSGVCRQGVCLPSELYFGPLGCGKGFLCCVSHF”, which consisted of 64 amino acids. Protein Basic Local Alignment Search Tool (BLASTP) of this sequence revealed 100% homology with the β-defensin-like protein 1, which is the first report of this antimicrobial peptide from epidermal mucus of C. carpio from Kashmir waters. |
| first_indexed | 2024-12-13T02:12:54Z |
| format | Article |
| id | doaj.art-1149c0e5a92c4835a7800f54550f56d8 |
| institution | Directory Open Access Journal |
| issn | 2352-5134 |
| language | English |
| last_indexed | 2024-12-13T02:12:54Z |
| publishDate | 2022-04-01 |
| publisher | Elsevier |
| record_format | Article |
| series | Aquaculture Reports |
| spelling | doaj.art-1149c0e5a92c4835a7800f54550f56d82022-12-22T00:02:58ZengElsevierAquaculture Reports2352-51342022-04-0123101056Isolation and characterization of β-defensin-like protein 1 from epidermal mucus of fungal infected fish (Cyprinus carpio) and assessment of its antimicrobial potenciesUzma Shabir0Jehangir Shafi Dar1Aashaq Hussain Bhat2Bashir Ahmad Ganai3Imtiaz Ahmad Khan4Centre of Research for Development, University of Kashmir, Srinagar 190006, Jammu and Kashmir, IndiaCentre of Research for Development, University of Kashmir, Srinagar 190006, Jammu and Kashmir, IndiaExperimental Biology Research Group, Institute of Biology, University of Neuchâtel, Rue Emile-Argand 11, 2000 Neuchâtel, SwitzerlandCentre of Research for Development, University of Kashmir, Srinagar 190006, Jammu and Kashmir, India; Corresponding author.Department of Zoology, University of Kashmir, Srinagar 190006, Jammu and Kashmir, IndiaFish epidermis is rich in different pharmacologically active substances, most of which play a crucial role in immunity. In the current study, β-defensin-like protein 1 with high in vitro antimicrobial activity was isolated and characterized from crude epidermal mucus extract of common carp, Cyprinus carpio L. The crude mucus was screened for antimicrobial activity against five bacterial and four fungal pathogens. Crude mucus exhibited varied antimicrobial activity against all the used pathogens. Sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) of crude mucus extract revealed multiple prominent bands with molecular weights corresponding to 6.9 kDa, 14.5 kDa, 24 kDa, 27 kDa and 48 kDa. Using Sephadex G-50 gel filtration liquid chromatography in conjunction with mass spectroscopy (LC/MS), a single peak with a molecular weight of 6908 Da was isolated and characterized. This peptide showed potent antimicrobial activity against all the five bacterial and four fungal strains used. Leclercia adecarboxylata and Enterobacter kobei were most susceptible with minimum inhibition concentration (MIC) value of 0.017 mg/mL, while Aeromonas sobria was least susceptible with an MIC of 2.24 mg/mL. Among the fungal pathogens, Candida glabrata was most susceptible with MIC value of 0.14 mg/mL, while Aspergillus sp. was least susceptible with MIC value of 4.48 mg/mL. The activity was further confirmed by the time kill assay. The antimicrobial peptide sequence determined from mass spectra was “PQSILVLLVLVVLALHCKENEAVSFPWSCASLSGVCRQGVCLPSELYFGPLGCGKGFLCCVSHF”, which consisted of 64 amino acids. Protein Basic Local Alignment Search Tool (BLASTP) of this sequence revealed 100% homology with the β-defensin-like protein 1, which is the first report of this antimicrobial peptide from epidermal mucus of C. carpio from Kashmir waters.http://www.sciencedirect.com/science/article/pii/S2352513422000527Antimicrobial peptideCyprinus carpioSodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS- PAGE)Liquid chromatographyMass spectroscopy |
| spellingShingle | Uzma Shabir Jehangir Shafi Dar Aashaq Hussain Bhat Bashir Ahmad Ganai Imtiaz Ahmad Khan Isolation and characterization of β-defensin-like protein 1 from epidermal mucus of fungal infected fish (Cyprinus carpio) and assessment of its antimicrobial potencies Aquaculture Reports Antimicrobial peptide Cyprinus carpio Sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS- PAGE) Liquid chromatography Mass spectroscopy |
| title | Isolation and characterization of β-defensin-like protein 1 from epidermal mucus of fungal infected fish (Cyprinus carpio) and assessment of its antimicrobial potencies |
| title_full | Isolation and characterization of β-defensin-like protein 1 from epidermal mucus of fungal infected fish (Cyprinus carpio) and assessment of its antimicrobial potencies |
| title_fullStr | Isolation and characterization of β-defensin-like protein 1 from epidermal mucus of fungal infected fish (Cyprinus carpio) and assessment of its antimicrobial potencies |
| title_full_unstemmed | Isolation and characterization of β-defensin-like protein 1 from epidermal mucus of fungal infected fish (Cyprinus carpio) and assessment of its antimicrobial potencies |
| title_short | Isolation and characterization of β-defensin-like protein 1 from epidermal mucus of fungal infected fish (Cyprinus carpio) and assessment of its antimicrobial potencies |
| title_sort | isolation and characterization of β defensin like protein 1 from epidermal mucus of fungal infected fish cyprinus carpio and assessment of its antimicrobial potencies |
| topic | Antimicrobial peptide Cyprinus carpio Sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS- PAGE) Liquid chromatography Mass spectroscopy |
| url | http://www.sciencedirect.com/science/article/pii/S2352513422000527 |
| work_keys_str_mv | AT uzmashabir isolationandcharacterizationofbdefensinlikeprotein1fromepidermalmucusoffungalinfectedfishcyprinuscarpioandassessmentofitsantimicrobialpotencies AT jehangirshafidar isolationandcharacterizationofbdefensinlikeprotein1fromepidermalmucusoffungalinfectedfishcyprinuscarpioandassessmentofitsantimicrobialpotencies AT aashaqhussainbhat isolationandcharacterizationofbdefensinlikeprotein1fromepidermalmucusoffungalinfectedfishcyprinuscarpioandassessmentofitsantimicrobialpotencies AT bashirahmadganai isolationandcharacterizationofbdefensinlikeprotein1fromepidermalmucusoffungalinfectedfishcyprinuscarpioandassessmentofitsantimicrobialpotencies AT imtiazahmadkhan isolationandcharacterizationofbdefensinlikeprotein1fromepidermalmucusoffungalinfectedfishcyprinuscarpioandassessmentofitsantimicrobialpotencies |