Convergence to equilibria for a three-dimensional conserved phase-field system with memory
We consider a conserved phase-field system with thermal memory on a tridimensional bounded domain. Assuming that the nonlinearity is real analytic, we use a Lojasiewicz-Simon type inequality to study the convergence to steady states of single trajectories. We also give an estimate of the conver...
| Main Author: | |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Texas State University
2008-02-01
|
| Series: | Electronic Journal of Differential Equations |
| Subjects: | |
| Online Access: | http://ejde.math.txstate.edu/Volumes/2008/23/abstr.html |
| _version_ | 1811322336187514880 |
|---|---|
| author | Gianluca Mola |
| author_facet | Gianluca Mola |
| author_sort | Gianluca Mola |
| collection | DOAJ |
| description | We consider a conserved phase-field system with thermal memory on a tridimensional bounded domain. Assuming that the nonlinearity is real analytic, we use a Lojasiewicz-Simon type inequality to study the convergence to steady states of single trajectories. We also give an estimate of the convergence rate. |
| first_indexed | 2024-04-13T13:33:24Z |
| format | Article |
| id | doaj.art-13d3a7c2f41f42d0872100f63d2ee3f8 |
| institution | Directory Open Access Journal |
| issn | 1072-6691 |
| language | English |
| last_indexed | 2024-04-13T13:33:24Z |
| publishDate | 2008-02-01 |
| publisher | Texas State University |
| record_format | Article |
| series | Electronic Journal of Differential Equations |
| spelling | doaj.art-13d3a7c2f41f42d0872100f63d2ee3f82022-12-22T02:44:52ZengTexas State UniversityElectronic Journal of Differential Equations1072-66912008-02-01200823116Convergence to equilibria for a three-dimensional conserved phase-field system with memoryGianluca MolaWe consider a conserved phase-field system with thermal memory on a tridimensional bounded domain. Assuming that the nonlinearity is real analytic, we use a Lojasiewicz-Simon type inequality to study the convergence to steady states of single trajectories. We also give an estimate of the convergence rate.http://ejde.math.txstate.edu/Volumes/2008/23/abstr.htmlConserved phase-field modelsmemory effectsLojasiewicz-Simon inequalitysteady statesglobal attractor |
| spellingShingle | Gianluca Mola Convergence to equilibria for a three-dimensional conserved phase-field system with memory Electronic Journal of Differential Equations Conserved phase-field models memory effects Lojasiewicz-Simon inequality steady states global attractor |
| title | Convergence to equilibria for a three-dimensional conserved phase-field system with memory |
| title_full | Convergence to equilibria for a three-dimensional conserved phase-field system with memory |
| title_fullStr | Convergence to equilibria for a three-dimensional conserved phase-field system with memory |
| title_full_unstemmed | Convergence to equilibria for a three-dimensional conserved phase-field system with memory |
| title_short | Convergence to equilibria for a three-dimensional conserved phase-field system with memory |
| title_sort | convergence to equilibria for a three dimensional conserved phase field system with memory |
| topic | Conserved phase-field models memory effects Lojasiewicz-Simon inequality steady states global attractor |
| url | http://ejde.math.txstate.edu/Volumes/2008/23/abstr.html |
| work_keys_str_mv | AT gianlucamola convergencetoequilibriaforathreedimensionalconservedphasefieldsystemwithmemory |