The Medicinal Halophyte <i>Frankenia laevis</i> L. (Sea Heath) Has In Vitro Antioxidant Activity, α-Glucosidase Inhibition, and Cytotoxicity towards Hepatocarcinoma Cells
This work explored the medicinal halophyte <i>Frankenia laevis</i> L. (sea heath) as a potential source of bioactive natural products. In this sense, methanol and dichloromethane extracts were prepared from aerial organs containing flowers, leaves and stems, and were profiled for their c...
| Main Authors: | , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
MDPI AG
2022-05-01
|
| Series: | Plants |
| Subjects: | |
| Online Access: | https://www.mdpi.com/2223-7747/11/10/1353 |
| _version_ | 1797496349170597888 |
|---|---|
| author | Maria João Rodrigues József Jekő Zoltán Cziáky Catarina G. Pereira Luísa Custódio |
| author_facet | Maria João Rodrigues József Jekő Zoltán Cziáky Catarina G. Pereira Luísa Custódio |
| author_sort | Maria João Rodrigues |
| collection | DOAJ |
| description | This work explored the medicinal halophyte <i>Frankenia laevis</i> L. (sea heath) as a potential source of bioactive natural products. In this sense, methanol and dichloromethane extracts were prepared from aerial organs containing flowers, leaves and stems, and were profiled for their chemical composition using high-performance liquid chromatography coupled with electrospray ionization mass spectrometry (HPLC-ESI-MS/MS). The extracts were evaluated for their in vitro antioxidant capacity using five complementary methods: enzyme inhibitory effects on enzymes related with neurodegeneration (acetyl (AChE) and butyrylcholinesterase (BuChE)), Type 2 diabetes (α-glucosidase and α-amylase), hyperpigmentation/food oxidation (tyrosinase), and cytotoxicity towards human hepatocarcinoma (HepG2) cells. Fifty-one molecules were identified in the extracts, including several derivatives of phenolic acids, lignans and flavonoids, monoterpenes, and hydroxylated derivatives of linoleic acid. The methanol extract was effective in DPPH and ABTS radical scavenging (EC<sub>50</sub> = 0.25 and 0.65 mg/mL, respectively), copper chelation (EC<sub>50</sub> = 0.78 mg/mL), and iron reduction (EC<sub>50</sub> = 0.51 mg/mL) activities, whereas the dichloromethane extract had high iron chelating ability (EC<sub>50</sub> = 0.76 mg/mL). Both extracts showed the capacity to inhibit α-glucosidase, especially the dichloromethane (EC<sub>50</sub> = 0.52 mg/mL). This extract also exerted a significant selective cytotoxicity towards HepG2 cells (EC<sub>50</sub> = 52.1 μg/mL, SI > 1.9). In conclusion, extracts from the aerial parts of sea heath were shown to be a promising source of natural products for pharmaceutical and/or food additive applications due to their high antioxidant, anti-diabetic, and cytotoxic properties. |
| first_indexed | 2024-03-10T03:02:24Z |
| format | Article |
| id | doaj.art-1603545d15af442fa473c64511d2db02 |
| institution | Directory Open Access Journal |
| issn | 2223-7747 |
| language | English |
| last_indexed | 2024-03-10T03:02:24Z |
| publishDate | 2022-05-01 |
| publisher | MDPI AG |
| record_format | Article |
| series | Plants |
| spelling | doaj.art-1603545d15af442fa473c64511d2db022023-11-23T12:42:47ZengMDPI AGPlants2223-77472022-05-011110135310.3390/plants11101353The Medicinal Halophyte <i>Frankenia laevis</i> L. (Sea Heath) Has In Vitro Antioxidant Activity, α-Glucosidase Inhibition, and Cytotoxicity towards Hepatocarcinoma CellsMaria João Rodrigues0József Jekő1Zoltán Cziáky2Catarina G. Pereira3Luísa Custódio4Centre of Marine Sciences, Faculty of Sciences and Technology, Campus of Gambelas, University of Algarve, 8005-139 Faro, PortugalAgricultural and Molecular Research and Service Institute, University of Nyíregyháza, 4400 Nyíregyháza, HungaryAgricultural and Molecular Research and Service Institute, University of Nyíregyháza, 4400 Nyíregyháza, HungaryCentre of Marine Sciences, Faculty of Sciences and Technology, Campus of Gambelas, University of Algarve, 8005-139 Faro, PortugalCentre of Marine Sciences, Faculty of Sciences and Technology, Campus of Gambelas, University of Algarve, 8005-139 Faro, PortugalThis work explored the medicinal halophyte <i>Frankenia laevis</i> L. (sea heath) as a potential source of bioactive natural products. In this sense, methanol and dichloromethane extracts were prepared from aerial organs containing flowers, leaves and stems, and were profiled for their chemical composition using high-performance liquid chromatography coupled with electrospray ionization mass spectrometry (HPLC-ESI-MS/MS). The extracts were evaluated for their in vitro antioxidant capacity using five complementary methods: enzyme inhibitory effects on enzymes related with neurodegeneration (acetyl (AChE) and butyrylcholinesterase (BuChE)), Type 2 diabetes (α-glucosidase and α-amylase), hyperpigmentation/food oxidation (tyrosinase), and cytotoxicity towards human hepatocarcinoma (HepG2) cells. Fifty-one molecules were identified in the extracts, including several derivatives of phenolic acids, lignans and flavonoids, monoterpenes, and hydroxylated derivatives of linoleic acid. The methanol extract was effective in DPPH and ABTS radical scavenging (EC<sub>50</sub> = 0.25 and 0.65 mg/mL, respectively), copper chelation (EC<sub>50</sub> = 0.78 mg/mL), and iron reduction (EC<sub>50</sub> = 0.51 mg/mL) activities, whereas the dichloromethane extract had high iron chelating ability (EC<sub>50</sub> = 0.76 mg/mL). Both extracts showed the capacity to inhibit α-glucosidase, especially the dichloromethane (EC<sub>50</sub> = 0.52 mg/mL). This extract also exerted a significant selective cytotoxicity towards HepG2 cells (EC<sub>50</sub> = 52.1 μg/mL, SI > 1.9). In conclusion, extracts from the aerial parts of sea heath were shown to be a promising source of natural products for pharmaceutical and/or food additive applications due to their high antioxidant, anti-diabetic, and cytotoxic properties.https://www.mdpi.com/2223-7747/11/10/1353salt-tolerant plants<i>Frankenia laevis</i>phenolicsmonoterpenestype 2 diabetesanti-tumor |
| spellingShingle | Maria João Rodrigues József Jekő Zoltán Cziáky Catarina G. Pereira Luísa Custódio The Medicinal Halophyte <i>Frankenia laevis</i> L. (Sea Heath) Has In Vitro Antioxidant Activity, α-Glucosidase Inhibition, and Cytotoxicity towards Hepatocarcinoma Cells Plants salt-tolerant plants <i>Frankenia laevis</i> phenolics monoterpenes type 2 diabetes anti-tumor |
| title | The Medicinal Halophyte <i>Frankenia laevis</i> L. (Sea Heath) Has In Vitro Antioxidant Activity, α-Glucosidase Inhibition, and Cytotoxicity towards Hepatocarcinoma Cells |
| title_full | The Medicinal Halophyte <i>Frankenia laevis</i> L. (Sea Heath) Has In Vitro Antioxidant Activity, α-Glucosidase Inhibition, and Cytotoxicity towards Hepatocarcinoma Cells |
| title_fullStr | The Medicinal Halophyte <i>Frankenia laevis</i> L. (Sea Heath) Has In Vitro Antioxidant Activity, α-Glucosidase Inhibition, and Cytotoxicity towards Hepatocarcinoma Cells |
| title_full_unstemmed | The Medicinal Halophyte <i>Frankenia laevis</i> L. (Sea Heath) Has In Vitro Antioxidant Activity, α-Glucosidase Inhibition, and Cytotoxicity towards Hepatocarcinoma Cells |
| title_short | The Medicinal Halophyte <i>Frankenia laevis</i> L. (Sea Heath) Has In Vitro Antioxidant Activity, α-Glucosidase Inhibition, and Cytotoxicity towards Hepatocarcinoma Cells |
| title_sort | medicinal halophyte i frankenia laevis i l sea heath has in vitro antioxidant activity α glucosidase inhibition and cytotoxicity towards hepatocarcinoma cells |
| topic | salt-tolerant plants <i>Frankenia laevis</i> phenolics monoterpenes type 2 diabetes anti-tumor |
| url | https://www.mdpi.com/2223-7747/11/10/1353 |
| work_keys_str_mv | AT mariajoaorodrigues themedicinalhalophyteifrankenialaevisilseaheathhasinvitroantioxidantactivityaglucosidaseinhibitionandcytotoxicitytowardshepatocarcinomacells AT jozsefjeko themedicinalhalophyteifrankenialaevisilseaheathhasinvitroantioxidantactivityaglucosidaseinhibitionandcytotoxicitytowardshepatocarcinomacells AT zoltancziaky themedicinalhalophyteifrankenialaevisilseaheathhasinvitroantioxidantactivityaglucosidaseinhibitionandcytotoxicitytowardshepatocarcinomacells AT catarinagpereira themedicinalhalophyteifrankenialaevisilseaheathhasinvitroantioxidantactivityaglucosidaseinhibitionandcytotoxicitytowardshepatocarcinomacells AT luisacustodio themedicinalhalophyteifrankenialaevisilseaheathhasinvitroantioxidantactivityaglucosidaseinhibitionandcytotoxicitytowardshepatocarcinomacells AT mariajoaorodrigues medicinalhalophyteifrankenialaevisilseaheathhasinvitroantioxidantactivityaglucosidaseinhibitionandcytotoxicitytowardshepatocarcinomacells AT jozsefjeko medicinalhalophyteifrankenialaevisilseaheathhasinvitroantioxidantactivityaglucosidaseinhibitionandcytotoxicitytowardshepatocarcinomacells AT zoltancziaky medicinalhalophyteifrankenialaevisilseaheathhasinvitroantioxidantactivityaglucosidaseinhibitionandcytotoxicitytowardshepatocarcinomacells AT catarinagpereira medicinalhalophyteifrankenialaevisilseaheathhasinvitroantioxidantactivityaglucosidaseinhibitionandcytotoxicitytowardshepatocarcinomacells AT luisacustodio medicinalhalophyteifrankenialaevisilseaheathhasinvitroantioxidantactivityaglucosidaseinhibitionandcytotoxicitytowardshepatocarcinomacells |