Energy budgets for juvenile Pacific whiteleg shrimp Litopenaeus vannamei fed different diets
Abstract Energy budgets for juvenile Pacific whiteleg shrimp, Litopenaeus vannamei (1.7-4.0 g ) fed with different diets were assessed. The energy partitioning between growth, respiration, ammonia excretion, feces and exuvia was calculated to estimate for total food energy intake. Shrimp oxygen cons...
| Main Authors: | , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Universidade de São Paulo
|
| Series: | Brazilian Journal of Oceanography |
| Subjects: | |
| Online Access: | http://www.scielo.br/scielo.php?script=sci_arttext&pid=S1679-87592019000100403&lng=en&tlng=en |
| _version_ | 1818789240055529472 |
|---|---|
| author | Rafael Tsuyoshi Inoe Coelho Fanny Ayumi Yasumaru Maria José Arruda Campos Rocha Passos Vicente Gomes Daniel Lemos |
| author_facet | Rafael Tsuyoshi Inoe Coelho Fanny Ayumi Yasumaru Maria José Arruda Campos Rocha Passos Vicente Gomes Daniel Lemos |
| author_sort | Rafael Tsuyoshi Inoe Coelho |
| collection | DOAJ |
| description | Abstract Energy budgets for juvenile Pacific whiteleg shrimp, Litopenaeus vannamei (1.7-4.0 g ) fed with different diets were assessed. The energy partitioning between growth, respiration, ammonia excretion, feces and exuvia was calculated to estimate for total food energy intake. Shrimp oxygen consumption and ammonia excretion were quantified in sealed chambers (25°C, 34 ppt). Energy allocated for growth and feces were obtained from the wet combustion of whole body and feces samples, exuvia was estimated as 10% growth energy. Three diets were tested: 100% chopped fish (Fish), 100% commercial feed (Feed), and 50-50% chopped fish and commercial feed (Mix). Most of the energy from the diets was channeled into respiration (49.7-70.5%). Shrimp fed the Feed diet used more energy in growth (24.4%) than those fed Mix (13.4%) or Fish diets (13.2%), either in absolute (joule) or relative (% of ingested energy) terms. Conversely, energy loss as ammonia excretion was lower in shrimp fed Feed (1.0%) compared to shrimp fed Mix (4.2%) or Fish diets (7.8%). Less energy was lost in feces by shrimp fed Fish diet (7.3%) compared to Mix (20.2%) and Feed diets (22.2%). The calculated energy intake by shrimp fed Fish, Mix and Feed were 0.995, 1.100, and 1.255 kJ ind-1day-1, respectively. According to the O:N atomic ratios (oxygen consumed to nitrogen excreted), protein tented to be the predominant substrate catabolized by shrimp fed Fish (O:N=16±5.2), and Mix (O:N=25±11.6), with increasing use of carbohydrates and/or lipids in the Feed (O:N=74±37.3). Results suggest diet composition may affect energy budget and partitioning differently between metabolism and growth either in absolute or relative terms, as shrimp fed Fish and Mix diets used protein as main substrate for metabolism, whereas shrimp fed Feed diet channeled protein for growth, and lipids and carbohydrates for other metabolic functions. |
| first_indexed | 2024-12-18T14:36:25Z |
| format | Article |
| id | doaj.art-17e1b88c013c4d589467d6b3d34dcd88 |
| institution | Directory Open Access Journal |
| issn | 1982-436X |
| language | English |
| last_indexed | 2024-12-18T14:36:25Z |
| publisher | Universidade de São Paulo |
| record_format | Article |
| series | Brazilian Journal of Oceanography |
| spelling | doaj.art-17e1b88c013c4d589467d6b3d34dcd882022-12-21T21:04:30ZengUniversidade de São PauloBrazilian Journal of Oceanography1982-436X6710.1590/s1679-87592019024306701S1679-87592019000100403Energy budgets for juvenile Pacific whiteleg shrimp Litopenaeus vannamei fed different dietsRafael Tsuyoshi Inoe CoelhoFanny Ayumi YasumaruMaria José Arruda Campos Rocha PassosVicente GomesDaniel LemosAbstract Energy budgets for juvenile Pacific whiteleg shrimp, Litopenaeus vannamei (1.7-4.0 g ) fed with different diets were assessed. The energy partitioning between growth, respiration, ammonia excretion, feces and exuvia was calculated to estimate for total food energy intake. Shrimp oxygen consumption and ammonia excretion were quantified in sealed chambers (25°C, 34 ppt). Energy allocated for growth and feces were obtained from the wet combustion of whole body and feces samples, exuvia was estimated as 10% growth energy. Three diets were tested: 100% chopped fish (Fish), 100% commercial feed (Feed), and 50-50% chopped fish and commercial feed (Mix). Most of the energy from the diets was channeled into respiration (49.7-70.5%). Shrimp fed the Feed diet used more energy in growth (24.4%) than those fed Mix (13.4%) or Fish diets (13.2%), either in absolute (joule) or relative (% of ingested energy) terms. Conversely, energy loss as ammonia excretion was lower in shrimp fed Feed (1.0%) compared to shrimp fed Mix (4.2%) or Fish diets (7.8%). Less energy was lost in feces by shrimp fed Fish diet (7.3%) compared to Mix (20.2%) and Feed diets (22.2%). The calculated energy intake by shrimp fed Fish, Mix and Feed were 0.995, 1.100, and 1.255 kJ ind-1day-1, respectively. According to the O:N atomic ratios (oxygen consumed to nitrogen excreted), protein tented to be the predominant substrate catabolized by shrimp fed Fish (O:N=16±5.2), and Mix (O:N=25±11.6), with increasing use of carbohydrates and/or lipids in the Feed (O:N=74±37.3). Results suggest diet composition may affect energy budget and partitioning differently between metabolism and growth either in absolute or relative terms, as shrimp fed Fish and Mix diets used protein as main substrate for metabolism, whereas shrimp fed Feed diet channeled protein for growth, and lipids and carbohydrates for other metabolic functions.http://www.scielo.br/scielo.php?script=sci_arttext&pid=S1679-87592019000100403&lng=en&tlng=enBioenergeticsShrimpEnergy partitioningGrowthFeed efficiencyLitopenaeus vannamei |
| spellingShingle | Rafael Tsuyoshi Inoe Coelho Fanny Ayumi Yasumaru Maria José Arruda Campos Rocha Passos Vicente Gomes Daniel Lemos Energy budgets for juvenile Pacific whiteleg shrimp Litopenaeus vannamei fed different diets Brazilian Journal of Oceanography Bioenergetics Shrimp Energy partitioning Growth Feed efficiency Litopenaeus vannamei |
| title | Energy budgets for juvenile Pacific whiteleg shrimp Litopenaeus vannamei fed different diets |
| title_full | Energy budgets for juvenile Pacific whiteleg shrimp Litopenaeus vannamei fed different diets |
| title_fullStr | Energy budgets for juvenile Pacific whiteleg shrimp Litopenaeus vannamei fed different diets |
| title_full_unstemmed | Energy budgets for juvenile Pacific whiteleg shrimp Litopenaeus vannamei fed different diets |
| title_short | Energy budgets for juvenile Pacific whiteleg shrimp Litopenaeus vannamei fed different diets |
| title_sort | energy budgets for juvenile pacific whiteleg shrimp litopenaeus vannamei fed different diets |
| topic | Bioenergetics Shrimp Energy partitioning Growth Feed efficiency Litopenaeus vannamei |
| url | http://www.scielo.br/scielo.php?script=sci_arttext&pid=S1679-87592019000100403&lng=en&tlng=en |
| work_keys_str_mv | AT rafaeltsuyoshiinoecoelho energybudgetsforjuvenilepacificwhitelegshrimplitopenaeusvannameifeddifferentdiets AT fannyayumiyasumaru energybudgetsforjuvenilepacificwhitelegshrimplitopenaeusvannameifeddifferentdiets AT mariajosearrudacamposrochapassos energybudgetsforjuvenilepacificwhitelegshrimplitopenaeusvannameifeddifferentdiets AT vicentegomes energybudgetsforjuvenilepacificwhitelegshrimplitopenaeusvannameifeddifferentdiets AT daniellemos energybudgetsforjuvenilepacificwhitelegshrimplitopenaeusvannameifeddifferentdiets |