Reflectivity and thickness analysis of epiretinal membranes using spectral-domain optical coherence tomography
AIM: To compare thickness and reflectivity spectral domain optical coherence tomography (SD-OCT) findings in patients with idiopathic epiretinal membranes (ERMs), before and after ERM peeling surgery, with normal controls. METHODS: A retrospective study analyzed SD-OCTs of eyes with ERMs undergoing...
| Main Authors: | , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Press of International Journal of Ophthalmology (IJO PRESS)
2016-01-01
|
| Series: | International Journal of Ophthalmology |
| Subjects: | |
| Online Access: | http://www.ijo.cn/en_publish/2016/1/20160116.pdf |
| _version_ | 1818948353653735424 |
|---|---|
| author | Ajay E. Kuriyan Delia Cabrera DeBuc William E. Smiddy |
| author_facet | Ajay E. Kuriyan Delia Cabrera DeBuc William E. Smiddy |
| author_sort | Ajay E. Kuriyan |
| collection | DOAJ |
| description | AIM: To compare thickness and reflectivity spectral domain optical coherence tomography (SD-OCT) findings in patients with idiopathic epiretinal membranes (ERMs), before and after ERM peeling surgery, with normal controls. METHODS: A retrospective study analyzed SD-OCTs of eyes with ERMs undergoing ERM peeling surgery by one surgeon from 2008 to 2010 and normal control eyes. SD-OCTs were analyzed using a customized algorithm to measure reflectivity and thickness. The relationship between the SD-OCT findings and best corrected visual acuity (BCVA) outcomes was also studied.
RESULTS: Thirty-four ERM eyes and 12 normal eyes were identified. Preoperative eyes had high reflectivity and thickness of the group of layers from the internal limiting membrane (ILM) to the retinal pigment epithelium (RPE) and the group of layers from the ILM to the external limiting membrane (ELM). The values of reflectivity of these two groups of layers decreased postoperatively, but were still higher than normal eyes. In contrast, preoperative eyes had lower reflectivity of two 10×15 pixel regions of interest (ROIs) incorporating: 1) ELM + outer nuclear layer (ONL) and 2) photoreceptor layer (PRL) + RPE, compared to controls. The values of reflectivity of these ROIs increased postoperatively, but were still lower than normal controls. A larger improvement in BCVA postoperatively was correlated with a greater degree of abnormal preoperative reflectivity and thickness findings.
CONCLUSION: Quantitative differences in reflectivity and thickness between preoperative, postoperative, and normal SD-OCTs allow assessment of changes in the retina secondary to ERM. Our study identified hyperreflective inner retina changes and hyporeflective outer retina changes in patients with ERMs. SD-OCT quantitative measures of reflectivity and/or thickness of specific groups of retinal layers and/or ROIs correlate with improvement in BCVA. |
| first_indexed | 2024-12-20T08:45:27Z |
| format | Article |
| id | doaj.art-1b1bc48f97d5440db07aa88743ae1fd1 |
| institution | Directory Open Access Journal |
| issn | 2222-3959 2227-4898 |
| language | English |
| last_indexed | 2024-12-20T08:45:27Z |
| publishDate | 2016-01-01 |
| publisher | Press of International Journal of Ophthalmology (IJO PRESS) |
| record_format | Article |
| series | International Journal of Ophthalmology |
| spelling | doaj.art-1b1bc48f97d5440db07aa88743ae1fd12022-12-21T19:46:16ZengPress of International Journal of Ophthalmology (IJO PRESS)International Journal of Ophthalmology2222-39592227-48982016-01-0191939810.18240/ijo.2016.01.16Reflectivity and thickness analysis of epiretinal membranes using spectral-domain optical coherence tomographyAjay E. Kuriyan0Delia Cabrera DeBuc1William E. Smiddy2Department of Ophthalmology, Bascom Palmer Eye Institute, Miller School of Medicine, University of Miami, Miami, Florida 33136, USADepartment of Ophthalmology, Bascom Palmer Eye Institute, Miller School of Medicine, University of Miami, Miami, Florida 33136, USADepartment of Ophthalmology, Bascom Palmer Eye Institute, Miller School of Medicine, University of Miami, Miami, Florida 33136, USAAIM: To compare thickness and reflectivity spectral domain optical coherence tomography (SD-OCT) findings in patients with idiopathic epiretinal membranes (ERMs), before and after ERM peeling surgery, with normal controls. METHODS: A retrospective study analyzed SD-OCTs of eyes with ERMs undergoing ERM peeling surgery by one surgeon from 2008 to 2010 and normal control eyes. SD-OCTs were analyzed using a customized algorithm to measure reflectivity and thickness. The relationship between the SD-OCT findings and best corrected visual acuity (BCVA) outcomes was also studied. RESULTS: Thirty-four ERM eyes and 12 normal eyes were identified. Preoperative eyes had high reflectivity and thickness of the group of layers from the internal limiting membrane (ILM) to the retinal pigment epithelium (RPE) and the group of layers from the ILM to the external limiting membrane (ELM). The values of reflectivity of these two groups of layers decreased postoperatively, but were still higher than normal eyes. In contrast, preoperative eyes had lower reflectivity of two 10×15 pixel regions of interest (ROIs) incorporating: 1) ELM + outer nuclear layer (ONL) and 2) photoreceptor layer (PRL) + RPE, compared to controls. The values of reflectivity of these ROIs increased postoperatively, but were still lower than normal controls. A larger improvement in BCVA postoperatively was correlated with a greater degree of abnormal preoperative reflectivity and thickness findings. CONCLUSION: Quantitative differences in reflectivity and thickness between preoperative, postoperative, and normal SD-OCTs allow assessment of changes in the retina secondary to ERM. Our study identified hyperreflective inner retina changes and hyporeflective outer retina changes in patients with ERMs. SD-OCT quantitative measures of reflectivity and/or thickness of specific groups of retinal layers and/or ROIs correlate with improvement in BCVA.http://www.ijo.cn/en_publish/2016/1/20160116.pdfepiretinal membranesoptical coherence tomographyreflectivityretinaimagingvitrectomy |
| spellingShingle | Ajay E. Kuriyan Delia Cabrera DeBuc William E. Smiddy Reflectivity and thickness analysis of epiretinal membranes using spectral-domain optical coherence tomography International Journal of Ophthalmology epiretinal membranes optical coherence tomography reflectivity retina imaging vitrectomy |
| title | Reflectivity and thickness analysis of epiretinal membranes using spectral-domain optical coherence tomography |
| title_full | Reflectivity and thickness analysis of epiretinal membranes using spectral-domain optical coherence tomography |
| title_fullStr | Reflectivity and thickness analysis of epiretinal membranes using spectral-domain optical coherence tomography |
| title_full_unstemmed | Reflectivity and thickness analysis of epiretinal membranes using spectral-domain optical coherence tomography |
| title_short | Reflectivity and thickness analysis of epiretinal membranes using spectral-domain optical coherence tomography |
| title_sort | reflectivity and thickness analysis of epiretinal membranes using spectral domain optical coherence tomography |
| topic | epiretinal membranes optical coherence tomography reflectivity retina imaging vitrectomy |
| url | http://www.ijo.cn/en_publish/2016/1/20160116.pdf |
| work_keys_str_mv | AT ajayekuriyan reflectivityandthicknessanalysisofepiretinalmembranesusingspectraldomainopticalcoherencetomography AT deliacabreradebuc reflectivityandthicknessanalysisofepiretinalmembranesusingspectraldomainopticalcoherencetomography AT williamesmiddy reflectivityandthicknessanalysisofepiretinalmembranesusingspectraldomainopticalcoherencetomography |