Characterization of the <i>WAK</i> Gene Family Reveals Genes for FHB Resistance in Bread Wheat (<i>Triticum aestivum</i> L.)
Wall-associated kinases (WAKs) are important receptor-like proteins that play major roles in plant defense against pathogens. Fusarium head blight (FHB), one of the most widespread and devastating crop diseases, reduces wheat yield and leads to quality deterioration. Although WAK gene families have...
| Main Authors: | , , , , , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
MDPI AG
2022-06-01
|
| Series: | International Journal of Molecular Sciences |
| Subjects: | |
| Online Access: | https://www.mdpi.com/1422-0067/23/13/7157 |
| _version_ | 1797479702721462272 |
|---|---|
| author | Xiaobo Xia Xu Zhang Yicong Zhang Lirong Wang Qi An Qiang Tu Lei Wu Peng Jiang Peng Zhang Lixuan Yu Gang Li Yi He |
| author_facet | Xiaobo Xia Xu Zhang Yicong Zhang Lirong Wang Qi An Qiang Tu Lei Wu Peng Jiang Peng Zhang Lixuan Yu Gang Li Yi He |
| author_sort | Xiaobo Xia |
| collection | DOAJ |
| description | Wall-associated kinases (WAKs) are important receptor-like proteins that play major roles in plant defense against pathogens. Fusarium head blight (FHB), one of the most widespread and devastating crop diseases, reduces wheat yield and leads to quality deterioration. Although WAK gene families have been studied in many plants, systematic research on bread wheat (<i>Triticum aestivum</i>) and its role in FHB resistance, in particular, is lacking. In this study, we identified and characterized 320 genes of the TaWAK family in wheat distributed across all chromosomes except 4B and divided them into three phylogenetic groups. Duplication and synteny analyses provided valuable information on the evolutionary characteristics of the <i>TaWAK</i> genes. The gene expression pattern analysis suggested that <i>TaWAK</i> genes play diverse roles in plant biological processes and that at least 30 genes may be involved in the response to Fusarium infection in wheat spikes, with most of the genes contributing to pectin- and chitin-induced defense pathways. Furthermore, 45 <i>TaWAK</i> genes were identified within 17 hcmQTLs that are related to wheat FHB resistance. Our findings provide potential candidate genes for improving FHB resistance and insights into the future functional analysis of <i>TaWAK</i> genes in wheat. |
| first_indexed | 2024-03-09T21:49:36Z |
| format | Article |
| id | doaj.art-1bcac839cc724d28a2d30c1192dc7035 |
| institution | Directory Open Access Journal |
| issn | 1661-6596 1422-0067 |
| language | English |
| last_indexed | 2024-03-09T21:49:36Z |
| publishDate | 2022-06-01 |
| publisher | MDPI AG |
| record_format | Article |
| series | International Journal of Molecular Sciences |
| spelling | doaj.art-1bcac839cc724d28a2d30c1192dc70352023-11-23T20:09:05ZengMDPI AGInternational Journal of Molecular Sciences1661-65961422-00672022-06-012313715710.3390/ijms23137157Characterization of the <i>WAK</i> Gene Family Reveals Genes for FHB Resistance in Bread Wheat (<i>Triticum aestivum</i> L.)Xiaobo Xia0Xu Zhang1Yicong Zhang2Lirong Wang3Qi An4Qiang Tu5Lei Wu6Peng Jiang7Peng Zhang8Lixuan Yu9Gang Li10Yi He11CIMMYT-JAAS Joint Center for Wheat Diseases, Key Laboratory of Germplasm Innovation in Downstream of Huaihe River (Nanjing), Ministry of Agriculture and Rural Affairs, Jiangsu Academy of Agricultural Sciences, Nanjing 210014, ChinaCIMMYT-JAAS Joint Center for Wheat Diseases, Key Laboratory of Germplasm Innovation in Downstream of Huaihe River (Nanjing), Ministry of Agriculture and Rural Affairs, Jiangsu Academy of Agricultural Sciences, Nanjing 210014, ChinaCIMMYT-JAAS Joint Center for Wheat Diseases, Key Laboratory of Germplasm Innovation in Downstream of Huaihe River (Nanjing), Ministry of Agriculture and Rural Affairs, Jiangsu Academy of Agricultural Sciences, Nanjing 210014, ChinaCIMMYT-JAAS Joint Center for Wheat Diseases, Key Laboratory of Germplasm Innovation in Downstream of Huaihe River (Nanjing), Ministry of Agriculture and Rural Affairs, Jiangsu Academy of Agricultural Sciences, Nanjing 210014, ChinaCIMMYT-JAAS Joint Center for Wheat Diseases, Key Laboratory of Germplasm Innovation in Downstream of Huaihe River (Nanjing), Ministry of Agriculture and Rural Affairs, Jiangsu Academy of Agricultural Sciences, Nanjing 210014, ChinaCIMMYT-JAAS Joint Center for Wheat Diseases, Key Laboratory of Germplasm Innovation in Downstream of Huaihe River (Nanjing), Ministry of Agriculture and Rural Affairs, Jiangsu Academy of Agricultural Sciences, Nanjing 210014, ChinaCIMMYT-JAAS Joint Center for Wheat Diseases, Key Laboratory of Germplasm Innovation in Downstream of Huaihe River (Nanjing), Ministry of Agriculture and Rural Affairs, Jiangsu Academy of Agricultural Sciences, Nanjing 210014, ChinaCIMMYT-JAAS Joint Center for Wheat Diseases, Key Laboratory of Germplasm Innovation in Downstream of Huaihe River (Nanjing), Ministry of Agriculture and Rural Affairs, Jiangsu Academy of Agricultural Sciences, Nanjing 210014, ChinaCIMMYT-JAAS Joint Center for Wheat Diseases, Key Laboratory of Germplasm Innovation in Downstream of Huaihe River (Nanjing), Ministry of Agriculture and Rural Affairs, Jiangsu Academy of Agricultural Sciences, Nanjing 210014, ChinaCIMMYT-JAAS Joint Center for Wheat Diseases, Key Laboratory of Germplasm Innovation in Downstream of Huaihe River (Nanjing), Ministry of Agriculture and Rural Affairs, Jiangsu Academy of Agricultural Sciences, Nanjing 210014, ChinaCollege of Plant Protection, Nanjing Agricultural University, Nanjing 210095, ChinaCIMMYT-JAAS Joint Center for Wheat Diseases, Key Laboratory of Germplasm Innovation in Downstream of Huaihe River (Nanjing), Ministry of Agriculture and Rural Affairs, Jiangsu Academy of Agricultural Sciences, Nanjing 210014, ChinaWall-associated kinases (WAKs) are important receptor-like proteins that play major roles in plant defense against pathogens. Fusarium head blight (FHB), one of the most widespread and devastating crop diseases, reduces wheat yield and leads to quality deterioration. Although WAK gene families have been studied in many plants, systematic research on bread wheat (<i>Triticum aestivum</i>) and its role in FHB resistance, in particular, is lacking. In this study, we identified and characterized 320 genes of the TaWAK family in wheat distributed across all chromosomes except 4B and divided them into three phylogenetic groups. Duplication and synteny analyses provided valuable information on the evolutionary characteristics of the <i>TaWAK</i> genes. The gene expression pattern analysis suggested that <i>TaWAK</i> genes play diverse roles in plant biological processes and that at least 30 genes may be involved in the response to Fusarium infection in wheat spikes, with most of the genes contributing to pectin- and chitin-induced defense pathways. Furthermore, 45 <i>TaWAK</i> genes were identified within 17 hcmQTLs that are related to wheat FHB resistance. Our findings provide potential candidate genes for improving FHB resistance and insights into the future functional analysis of <i>TaWAK</i> genes in wheat.https://www.mdpi.com/1422-0067/23/13/7157wheatwall-associated kinase<i>TaWAK</i>gene familygene expressionFusarium head blight |
| spellingShingle | Xiaobo Xia Xu Zhang Yicong Zhang Lirong Wang Qi An Qiang Tu Lei Wu Peng Jiang Peng Zhang Lixuan Yu Gang Li Yi He Characterization of the <i>WAK</i> Gene Family Reveals Genes for FHB Resistance in Bread Wheat (<i>Triticum aestivum</i> L.) International Journal of Molecular Sciences wheat wall-associated kinase <i>TaWAK</i> gene family gene expression Fusarium head blight |
| title | Characterization of the <i>WAK</i> Gene Family Reveals Genes for FHB Resistance in Bread Wheat (<i>Triticum aestivum</i> L.) |
| title_full | Characterization of the <i>WAK</i> Gene Family Reveals Genes for FHB Resistance in Bread Wheat (<i>Triticum aestivum</i> L.) |
| title_fullStr | Characterization of the <i>WAK</i> Gene Family Reveals Genes for FHB Resistance in Bread Wheat (<i>Triticum aestivum</i> L.) |
| title_full_unstemmed | Characterization of the <i>WAK</i> Gene Family Reveals Genes for FHB Resistance in Bread Wheat (<i>Triticum aestivum</i> L.) |
| title_short | Characterization of the <i>WAK</i> Gene Family Reveals Genes for FHB Resistance in Bread Wheat (<i>Triticum aestivum</i> L.) |
| title_sort | characterization of the i wak i gene family reveals genes for fhb resistance in bread wheat i triticum aestivum i l |
| topic | wheat wall-associated kinase <i>TaWAK</i> gene family gene expression Fusarium head blight |
| url | https://www.mdpi.com/1422-0067/23/13/7157 |
| work_keys_str_mv | AT xiaoboxia characterizationoftheiwakigenefamilyrevealsgenesforfhbresistanceinbreadwheatitriticumaestivumil AT xuzhang characterizationoftheiwakigenefamilyrevealsgenesforfhbresistanceinbreadwheatitriticumaestivumil AT yicongzhang characterizationoftheiwakigenefamilyrevealsgenesforfhbresistanceinbreadwheatitriticumaestivumil AT lirongwang characterizationoftheiwakigenefamilyrevealsgenesforfhbresistanceinbreadwheatitriticumaestivumil AT qian characterizationoftheiwakigenefamilyrevealsgenesforfhbresistanceinbreadwheatitriticumaestivumil AT qiangtu characterizationoftheiwakigenefamilyrevealsgenesforfhbresistanceinbreadwheatitriticumaestivumil AT leiwu characterizationoftheiwakigenefamilyrevealsgenesforfhbresistanceinbreadwheatitriticumaestivumil AT pengjiang characterizationoftheiwakigenefamilyrevealsgenesforfhbresistanceinbreadwheatitriticumaestivumil AT pengzhang characterizationoftheiwakigenefamilyrevealsgenesforfhbresistanceinbreadwheatitriticumaestivumil AT lixuanyu characterizationoftheiwakigenefamilyrevealsgenesforfhbresistanceinbreadwheatitriticumaestivumil AT gangli characterizationoftheiwakigenefamilyrevealsgenesforfhbresistanceinbreadwheatitriticumaestivumil AT yihe characterizationoftheiwakigenefamilyrevealsgenesforfhbresistanceinbreadwheatitriticumaestivumil |