Effects of the dietary zinc source and vitamin E level on live weight and carcass yield and meat quality in male broilers reared under chronic cyclic heat stress conditions in the finisher phase
The objective of this study was to evaluate the effect of the interaction of the zinc source (ZnSO4 vs. zinc amino acid complex) and vitamin E level (50 IU/kg vs. 100 IU/kg) on meat yield and quality in broilers subjected to chronic cyclic heat stress in the finisher phase. A total of 1224 one-day-o...
| Main Authors: | , , , , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Frontiers Media S.A.
2022-10-01
|
| Series: | Frontiers in Physiology |
| Subjects: | |
| Online Access: | https://www.frontiersin.org/articles/10.3389/fphys.2022.992689/full |
| _version_ | 1811229337153699840 |
|---|---|
| author | Annatachja De Grande Annatachja De Grande Richard Ducatelle Saskia Leleu Christof Rapp Cibele Torres Massimiliano Petracci Stefaan De Smet Joris Michiels Freddy Haesebrouck Filip Van Immerseel Evelyne Delezie |
| author_facet | Annatachja De Grande Annatachja De Grande Richard Ducatelle Saskia Leleu Christof Rapp Cibele Torres Massimiliano Petracci Stefaan De Smet Joris Michiels Freddy Haesebrouck Filip Van Immerseel Evelyne Delezie |
| author_sort | Annatachja De Grande |
| collection | DOAJ |
| description | The objective of this study was to evaluate the effect of the interaction of the zinc source (ZnSO4 vs. zinc amino acid complex) and vitamin E level (50 IU/kg vs. 100 IU/kg) on meat yield and quality in broilers subjected to chronic cyclic heat stress in the finisher phase. A total of 1224 one-day-old male Ross 308 broilers were randomly distributed among four dietary treatments. Each treatment contained nine replicates of 34 birds, housed in floor pens in a temperature- and lighting-controlled room. Treatments were organized in a 2 × 2 factorial arrangement: two sources of zinc, 60 mg/kg of Zn as ZnSO4 or 60 mg/kg of Zn as zinc amino acid complexes (ZnAA), combined with two levels of vitamin E (50 or 100 IU/kg). From day 28 until day 37 (finisher phase), all birds were subjected to chronic cyclic heat stress (32 ± 2°C for 6 h daily). In the present study, it was observed that replacing ZnSO4 with ZnAA increased breast meat weight and yield of broilers reared under chronic cyclic heat stress conditions, whereas total slaughter yield was not affected. Moreover, it was observed that replacing ZnSO4 with ZnAA resulted in breast meat with a lower drip and thawing loss and a higher marinade uptake. In conclusion, replacing ZnSO4 with more readily available ZnAA can improve breast meat yield and increase the water-holding capacity of breast meat of broilers exposed to chronic cyclic heat stress at the end of the production cycle. However, as no thermoneutral group was included in the present study, the observed effects of the zinc source cannot be generalized as a solution for heat stress. Moreover, the beneficial effects of ZnAA on breast meat yield and quality seem to be independent of the vitamin E level, and increasing vitamin E level has no additional beneficial effects. |
| first_indexed | 2024-04-12T10:13:13Z |
| format | Article |
| id | doaj.art-1d036e4ba72547a3a727fd3349fb3aac |
| institution | Directory Open Access Journal |
| issn | 1664-042X |
| language | English |
| last_indexed | 2024-04-12T10:13:13Z |
| publishDate | 2022-10-01 |
| publisher | Frontiers Media S.A. |
| record_format | Article |
| series | Frontiers in Physiology |
| spelling | doaj.art-1d036e4ba72547a3a727fd3349fb3aac2022-12-22T03:37:15ZengFrontiers Media S.A.Frontiers in Physiology1664-042X2022-10-011310.3389/fphys.2022.992689992689Effects of the dietary zinc source and vitamin E level on live weight and carcass yield and meat quality in male broilers reared under chronic cyclic heat stress conditions in the finisher phaseAnnatachja De Grande0Annatachja De Grande1Richard Ducatelle2Saskia Leleu3Christof Rapp4Cibele Torres5Massimiliano Petracci6Stefaan De Smet7Joris Michiels8Freddy Haesebrouck9Filip Van Immerseel10Evelyne Delezie11Research Institute for Agriculture, Fisheries and Food (ILVO), Merelbeke, BelgiumDepartment of Pathobiology, Pharmacology and Zoological Medicine, Ghent University, Merelbeke, BelgiumDepartment of Pathobiology, Pharmacology and Zoological Medicine, Ghent University, Merelbeke, BelgiumResearch Institute for Agriculture, Fisheries and Food (ILVO), Merelbeke, BelgiumZinpro Corporation, Boxmeer, NetherlandsZinpro Corporation, Boxmeer, NetherlandsDepartment of Agricultural and Food Sciences, Alma Mater Studiorum, University of Bologna, Cesena, ItalyDepartment of Animal Sciences and Aquatic Ecology, Ghent University, Ghent, BelgiumDepartment of Animal Sciences and Aquatic Ecology, Ghent University, Ghent, BelgiumDepartment of Pathobiology, Pharmacology and Zoological Medicine, Ghent University, Merelbeke, BelgiumDepartment of Pathobiology, Pharmacology and Zoological Medicine, Ghent University, Merelbeke, BelgiumResearch Institute for Agriculture, Fisheries and Food (ILVO), Merelbeke, BelgiumThe objective of this study was to evaluate the effect of the interaction of the zinc source (ZnSO4 vs. zinc amino acid complex) and vitamin E level (50 IU/kg vs. 100 IU/kg) on meat yield and quality in broilers subjected to chronic cyclic heat stress in the finisher phase. A total of 1224 one-day-old male Ross 308 broilers were randomly distributed among four dietary treatments. Each treatment contained nine replicates of 34 birds, housed in floor pens in a temperature- and lighting-controlled room. Treatments were organized in a 2 × 2 factorial arrangement: two sources of zinc, 60 mg/kg of Zn as ZnSO4 or 60 mg/kg of Zn as zinc amino acid complexes (ZnAA), combined with two levels of vitamin E (50 or 100 IU/kg). From day 28 until day 37 (finisher phase), all birds were subjected to chronic cyclic heat stress (32 ± 2°C for 6 h daily). In the present study, it was observed that replacing ZnSO4 with ZnAA increased breast meat weight and yield of broilers reared under chronic cyclic heat stress conditions, whereas total slaughter yield was not affected. Moreover, it was observed that replacing ZnSO4 with ZnAA resulted in breast meat with a lower drip and thawing loss and a higher marinade uptake. In conclusion, replacing ZnSO4 with more readily available ZnAA can improve breast meat yield and increase the water-holding capacity of breast meat of broilers exposed to chronic cyclic heat stress at the end of the production cycle. However, as no thermoneutral group was included in the present study, the observed effects of the zinc source cannot be generalized as a solution for heat stress. Moreover, the beneficial effects of ZnAA on breast meat yield and quality seem to be independent of the vitamin E level, and increasing vitamin E level has no additional beneficial effects.https://www.frontiersin.org/articles/10.3389/fphys.2022.992689/fullzincvitamin Ebroilercarcass yieldmeat qualityheat stress |
| spellingShingle | Annatachja De Grande Annatachja De Grande Richard Ducatelle Saskia Leleu Christof Rapp Cibele Torres Massimiliano Petracci Stefaan De Smet Joris Michiels Freddy Haesebrouck Filip Van Immerseel Evelyne Delezie Effects of the dietary zinc source and vitamin E level on live weight and carcass yield and meat quality in male broilers reared under chronic cyclic heat stress conditions in the finisher phase Frontiers in Physiology zinc vitamin E broiler carcass yield meat quality heat stress |
| title | Effects of the dietary zinc source and vitamin E level on live weight and carcass yield and meat quality in male broilers reared under chronic cyclic heat stress conditions in the finisher phase |
| title_full | Effects of the dietary zinc source and vitamin E level on live weight and carcass yield and meat quality in male broilers reared under chronic cyclic heat stress conditions in the finisher phase |
| title_fullStr | Effects of the dietary zinc source and vitamin E level on live weight and carcass yield and meat quality in male broilers reared under chronic cyclic heat stress conditions in the finisher phase |
| title_full_unstemmed | Effects of the dietary zinc source and vitamin E level on live weight and carcass yield and meat quality in male broilers reared under chronic cyclic heat stress conditions in the finisher phase |
| title_short | Effects of the dietary zinc source and vitamin E level on live weight and carcass yield and meat quality in male broilers reared under chronic cyclic heat stress conditions in the finisher phase |
| title_sort | effects of the dietary zinc source and vitamin e level on live weight and carcass yield and meat quality in male broilers reared under chronic cyclic heat stress conditions in the finisher phase |
| topic | zinc vitamin E broiler carcass yield meat quality heat stress |
| url | https://www.frontiersin.org/articles/10.3389/fphys.2022.992689/full |
| work_keys_str_mv | AT annatachjadegrande effectsofthedietaryzincsourceandvitaminelevelonliveweightandcarcassyieldandmeatqualityinmalebroilersrearedunderchroniccyclicheatstressconditionsinthefinisherphase AT annatachjadegrande effectsofthedietaryzincsourceandvitaminelevelonliveweightandcarcassyieldandmeatqualityinmalebroilersrearedunderchroniccyclicheatstressconditionsinthefinisherphase AT richardducatelle effectsofthedietaryzincsourceandvitaminelevelonliveweightandcarcassyieldandmeatqualityinmalebroilersrearedunderchroniccyclicheatstressconditionsinthefinisherphase AT saskialeleu effectsofthedietaryzincsourceandvitaminelevelonliveweightandcarcassyieldandmeatqualityinmalebroilersrearedunderchroniccyclicheatstressconditionsinthefinisherphase AT christofrapp effectsofthedietaryzincsourceandvitaminelevelonliveweightandcarcassyieldandmeatqualityinmalebroilersrearedunderchroniccyclicheatstressconditionsinthefinisherphase AT cibeletorres effectsofthedietaryzincsourceandvitaminelevelonliveweightandcarcassyieldandmeatqualityinmalebroilersrearedunderchroniccyclicheatstressconditionsinthefinisherphase AT massimilianopetracci effectsofthedietaryzincsourceandvitaminelevelonliveweightandcarcassyieldandmeatqualityinmalebroilersrearedunderchroniccyclicheatstressconditionsinthefinisherphase AT stefaandesmet effectsofthedietaryzincsourceandvitaminelevelonliveweightandcarcassyieldandmeatqualityinmalebroilersrearedunderchroniccyclicheatstressconditionsinthefinisherphase AT jorismichiels effectsofthedietaryzincsourceandvitaminelevelonliveweightandcarcassyieldandmeatqualityinmalebroilersrearedunderchroniccyclicheatstressconditionsinthefinisherphase AT freddyhaesebrouck effectsofthedietaryzincsourceandvitaminelevelonliveweightandcarcassyieldandmeatqualityinmalebroilersrearedunderchroniccyclicheatstressconditionsinthefinisherphase AT filipvanimmerseel effectsofthedietaryzincsourceandvitaminelevelonliveweightandcarcassyieldandmeatqualityinmalebroilersrearedunderchroniccyclicheatstressconditionsinthefinisherphase AT evelynedelezie effectsofthedietaryzincsourceandvitaminelevelonliveweightandcarcassyieldandmeatqualityinmalebroilersrearedunderchroniccyclicheatstressconditionsinthefinisherphase |