Climate warming may facilitate invasion of the exotic shrub Lantana camara.
Plant species show different responses to the elevated temperatures that are resulting from global climate change, depending on their ecological and physiological characteristics. The highly invasive shrub Lantana camara occurs between the latitudes of 35 °N and 35 °S. According to current and futur...
| Main Authors: | , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Public Library of Science (PLoS)
2014-01-01
|
| Series: | PLoS ONE |
| Online Access: | http://europepmc.org/articles/PMC4153567?pdf=render |
| _version_ | 1828364179980943360 |
|---|---|
| author | Qiaoying Zhang Yunchun Zhang Shaolin Peng Kristjan Zobel |
| author_facet | Qiaoying Zhang Yunchun Zhang Shaolin Peng Kristjan Zobel |
| author_sort | Qiaoying Zhang |
| collection | DOAJ |
| description | Plant species show different responses to the elevated temperatures that are resulting from global climate change, depending on their ecological and physiological characteristics. The highly invasive shrub Lantana camara occurs between the latitudes of 35 °N and 35 °S. According to current and future climate scenarios predicted by the CLIMEX model, climatically suitable areas for L. camara are projected to contract globally, despite expansions in some areas. The objective of this study was to test those predictions, using a pot experiment in which branch cuttings were grown at three different temperatures (22 °C, 26 °C and 30 °C). We hypothesized that warming would facilitate the invasiveness of L. camara. In response to rising temperatures, the total biomass of L. camara did increase. Plants allocated more biomass to stems and enlarged their leaves more at 26 °C and 30 °C, which promoted light capture and assimilation. They did not appear to be stressed by higher temperatures, in fact photosynthesis and assimilation were enhanced. Using lettuce (Lactuca sativa) as a receptor plant in a bioassay experiment, we also tested the phytotoxicity of L. camara leachate at different temperatures. All aqueous extracts from fresh leaves significantly inhibited the germination and seedling growth of lettuce, and the allelopathic effects became stronger with increasing temperature. Our results provide key evidence that elevated temperature led to significant increases in growth along with physiological and allelopathic effects, which together indicate that global warming facilitates the invasion of L. camara. |
| first_indexed | 2024-04-14T05:12:19Z |
| format | Article |
| id | doaj.art-1de2e09d99ea4252b77736b349aa0ba3 |
| institution | Directory Open Access Journal |
| issn | 1932-6203 |
| language | English |
| last_indexed | 2024-04-14T05:12:19Z |
| publishDate | 2014-01-01 |
| publisher | Public Library of Science (PLoS) |
| record_format | Article |
| series | PLoS ONE |
| spelling | doaj.art-1de2e09d99ea4252b77736b349aa0ba32022-12-22T02:10:29ZengPublic Library of Science (PLoS)PLoS ONE1932-62032014-01-0199e10550010.1371/journal.pone.0105500Climate warming may facilitate invasion of the exotic shrub Lantana camara.Qiaoying ZhangYunchun ZhangShaolin PengKristjan ZobelPlant species show different responses to the elevated temperatures that are resulting from global climate change, depending on their ecological and physiological characteristics. The highly invasive shrub Lantana camara occurs between the latitudes of 35 °N and 35 °S. According to current and future climate scenarios predicted by the CLIMEX model, climatically suitable areas for L. camara are projected to contract globally, despite expansions in some areas. The objective of this study was to test those predictions, using a pot experiment in which branch cuttings were grown at three different temperatures (22 °C, 26 °C and 30 °C). We hypothesized that warming would facilitate the invasiveness of L. camara. In response to rising temperatures, the total biomass of L. camara did increase. Plants allocated more biomass to stems and enlarged their leaves more at 26 °C and 30 °C, which promoted light capture and assimilation. They did not appear to be stressed by higher temperatures, in fact photosynthesis and assimilation were enhanced. Using lettuce (Lactuca sativa) as a receptor plant in a bioassay experiment, we also tested the phytotoxicity of L. camara leachate at different temperatures. All aqueous extracts from fresh leaves significantly inhibited the germination and seedling growth of lettuce, and the allelopathic effects became stronger with increasing temperature. Our results provide key evidence that elevated temperature led to significant increases in growth along with physiological and allelopathic effects, which together indicate that global warming facilitates the invasion of L. camara.http://europepmc.org/articles/PMC4153567?pdf=render |
| spellingShingle | Qiaoying Zhang Yunchun Zhang Shaolin Peng Kristjan Zobel Climate warming may facilitate invasion of the exotic shrub Lantana camara. PLoS ONE |
| title | Climate warming may facilitate invasion of the exotic shrub Lantana camara. |
| title_full | Climate warming may facilitate invasion of the exotic shrub Lantana camara. |
| title_fullStr | Climate warming may facilitate invasion of the exotic shrub Lantana camara. |
| title_full_unstemmed | Climate warming may facilitate invasion of the exotic shrub Lantana camara. |
| title_short | Climate warming may facilitate invasion of the exotic shrub Lantana camara. |
| title_sort | climate warming may facilitate invasion of the exotic shrub lantana camara |
| url | http://europepmc.org/articles/PMC4153567?pdf=render |
| work_keys_str_mv | AT qiaoyingzhang climatewarmingmayfacilitateinvasionoftheexoticshrublantanacamara AT yunchunzhang climatewarmingmayfacilitateinvasionoftheexoticshrublantanacamara AT shaolinpeng climatewarmingmayfacilitateinvasionoftheexoticshrublantanacamara AT kristjanzobel climatewarmingmayfacilitateinvasionoftheexoticshrublantanacamara |