A new three‐level simplified sparce NPC topology for UHS PMSM motor applications
Abstract In ultra‐high speed (UHS) motor applications, full SIC two‐level (2L) inverters with high switching frequencies are generally used due to their lower cost. However, even with the usage of all WBG power devices, high‐frequency hard‐switched 2L inverters still do not achieve optimal efficienc...
| Main Authors: | , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Wiley
2024-04-01
|
| Series: | IET Electric Power Applications |
| Subjects: | |
| Online Access: | https://doi.org/10.1049/elp2.12405 |
| _version_ | 1797202091489361920 |
|---|---|
| author | Aleksandr Sheianov Xi Xiao Xudong Sun |
| author_facet | Aleksandr Sheianov Xi Xiao Xudong Sun |
| author_sort | Aleksandr Sheianov |
| collection | DOAJ |
| description | Abstract In ultra‐high speed (UHS) motor applications, full SIC two‐level (2L) inverters with high switching frequencies are generally used due to their lower cost. However, even with the usage of all WBG power devices, high‐frequency hard‐switched 2L inverters still do not achieve optimal efficiency characteristics. As a result, in order to simultaneously reduce the switching frequency and enhance overall efficiency, recently three‐level (3L) topologies have emerged as a promising solution. Nevertheless, to fully meet the requirements of UHS applications, the switching frequency of 3L inverters should be increased beyond 30 kHz, which necessitates the usage of all SIC power devices. This, in turn, leads to a potential drawback where the cost of the drive system may become prohibitively high due to the requirement of all SIC switches. To address this issue and reduce the cost of a full SIC 3L inverter, a new 3L simplified sparse NPC (SSNPC) topology is proposed in this work. The operational principle of this topology, its distinctive control features, and the advantages it offers specifically for UHS applications are presented. Additionally, to further increase the efficiency and reduce the influence of dead time at low speeds, a new switching sequence is introduced. Finally, the overall performance and efficiency characteristics of the high‐frequency SSNPC inverter were verified across all operational conditions of UHS motor drive system. |
| first_indexed | 2024-04-24T07:57:56Z |
| format | Article |
| id | doaj.art-1e3f598f275545299868d9d167392b43 |
| institution | Directory Open Access Journal |
| issn | 1751-8660 1751-8679 |
| language | English |
| last_indexed | 2024-04-24T07:57:56Z |
| publishDate | 2024-04-01 |
| publisher | Wiley |
| record_format | Article |
| series | IET Electric Power Applications |
| spelling | doaj.art-1e3f598f275545299868d9d167392b432024-04-18T03:56:45ZengWileyIET Electric Power Applications1751-86601751-86792024-04-0118445847610.1049/elp2.12405A new three‐level simplified sparce NPC topology for UHS PMSM motor applicationsAleksandr Sheianov0Xi Xiao1Xudong Sun2Electrical Engineering Department Tsinghua University Beijing ChinaElectrical Engineering Department Tsinghua University Beijing ChinaElectrical Engineering Department Tsinghua University Beijing ChinaAbstract In ultra‐high speed (UHS) motor applications, full SIC two‐level (2L) inverters with high switching frequencies are generally used due to their lower cost. However, even with the usage of all WBG power devices, high‐frequency hard‐switched 2L inverters still do not achieve optimal efficiency characteristics. As a result, in order to simultaneously reduce the switching frequency and enhance overall efficiency, recently three‐level (3L) topologies have emerged as a promising solution. Nevertheless, to fully meet the requirements of UHS applications, the switching frequency of 3L inverters should be increased beyond 30 kHz, which necessitates the usage of all SIC power devices. This, in turn, leads to a potential drawback where the cost of the drive system may become prohibitively high due to the requirement of all SIC switches. To address this issue and reduce the cost of a full SIC 3L inverter, a new 3L simplified sparse NPC (SSNPC) topology is proposed in this work. The operational principle of this topology, its distinctive control features, and the advantages it offers specifically for UHS applications are presented. Additionally, to further increase the efficiency and reduce the influence of dead time at low speeds, a new switching sequence is introduced. Finally, the overall performance and efficiency characteristics of the high‐frequency SSNPC inverter were verified across all operational conditions of UHS motor drive system.https://doi.org/10.1049/elp2.12405AC motor drivesDC‐AC power convertorspermanent magnet motorsPWM invertors |
| spellingShingle | Aleksandr Sheianov Xi Xiao Xudong Sun A new three‐level simplified sparce NPC topology for UHS PMSM motor applications IET Electric Power Applications AC motor drives DC‐AC power convertors permanent magnet motors PWM invertors |
| title | A new three‐level simplified sparce NPC topology for UHS PMSM motor applications |
| title_full | A new three‐level simplified sparce NPC topology for UHS PMSM motor applications |
| title_fullStr | A new three‐level simplified sparce NPC topology for UHS PMSM motor applications |
| title_full_unstemmed | A new three‐level simplified sparce NPC topology for UHS PMSM motor applications |
| title_short | A new three‐level simplified sparce NPC topology for UHS PMSM motor applications |
| title_sort | new three level simplified sparce npc topology for uhs pmsm motor applications |
| topic | AC motor drives DC‐AC power convertors permanent magnet motors PWM invertors |
| url | https://doi.org/10.1049/elp2.12405 |
| work_keys_str_mv | AT aleksandrsheianov anewthreelevelsimplifiedsparcenpctopologyforuhspmsmmotorapplications AT xixiao anewthreelevelsimplifiedsparcenpctopologyforuhspmsmmotorapplications AT xudongsun anewthreelevelsimplifiedsparcenpctopologyforuhspmsmmotorapplications AT aleksandrsheianov newthreelevelsimplifiedsparcenpctopologyforuhspmsmmotorapplications AT xixiao newthreelevelsimplifiedsparcenpctopologyforuhspmsmmotorapplications AT xudongsun newthreelevelsimplifiedsparcenpctopologyforuhspmsmmotorapplications |