The Swine Erysipelas Vaccine SER-ME Effectively Protects Pigs against Challenge with the <i>Erysipelothrix rhusiopathiae</i> M203/I257 SpaA-Type Variant
<i>Erysipelothrix rhusiopathiae</i> causes swine erysipelas (SE). Sporadic SE outbreaks in Japan are mostly caused by the <i>E. rhusiopathiae</i> serovar 1a variant featured by methionine (M) and isoleucine (I) at amino acid positions 203 and 257 of the surface protective ant...
| Main Authors: | , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
MDPI AG
2022-07-01
|
| Series: | Veterinary Sciences |
| Subjects: | |
| Online Access: | https://www.mdpi.com/2306-7381/9/8/382 |
| _version_ | 1827617477948866560 |
|---|---|
| author | Misako Morimoto Atsushi Kato Kotoe Nogami Yuta Akaike Takaaki Furusawa Hiroe Kojima Chihiro Sasakawa |
| author_facet | Misako Morimoto Atsushi Kato Kotoe Nogami Yuta Akaike Takaaki Furusawa Hiroe Kojima Chihiro Sasakawa |
| author_sort | Misako Morimoto |
| collection | DOAJ |
| description | <i>Erysipelothrix rhusiopathiae</i> causes swine erysipelas (SE). Sporadic SE outbreaks in Japan are mostly caused by the <i>E. rhusiopathiae</i> serovar 1a variant featured by methionine (M) and isoleucine (I) at amino acid positions 203 and 257 of the surface protective antigen (Spa) A protein (M203/I257 SpaA-type). To determine if current vaccines are effective against infection with this variant in pigs, one representative inactivated vaccine, SER-ME (containing <i>E. rhusiopathiae</i> serovar 2a), was evaluated. All vaccinated pigs survived without any apparent clinical signs after lethal challenge with the Fujisawa reference strain or the variant. This indicates that the SER-ME vaccine effectively protects pigs against the infection of <i>E. rhusiopathiae</i> M203/I257 SpaA-type variant. Current vaccines in Japan, including SER-ME, suggest that outbreaks in Japan are unlikely caused by vaccine failure. |
| first_indexed | 2024-03-09T09:47:34Z |
| format | Article |
| id | doaj.art-1fd51ccc61174a42a55a7dcc3571c2b0 |
| institution | Directory Open Access Journal |
| issn | 2306-7381 |
| language | English |
| last_indexed | 2024-03-09T09:47:34Z |
| publishDate | 2022-07-01 |
| publisher | MDPI AG |
| record_format | Article |
| series | Veterinary Sciences |
| spelling | doaj.art-1fd51ccc61174a42a55a7dcc3571c2b02023-12-02T00:27:15ZengMDPI AGVeterinary Sciences2306-73812022-07-019838210.3390/vetsci9080382The Swine Erysipelas Vaccine SER-ME Effectively Protects Pigs against Challenge with the <i>Erysipelothrix rhusiopathiae</i> M203/I257 SpaA-Type VariantMisako Morimoto0Atsushi Kato1Kotoe Nogami2Yuta Akaike3Takaaki Furusawa4Hiroe Kojima5Chihiro Sasakawa6Nippon Institute for Biological Science, 9-2221-1 Shin-machi, Ome 198-0024, Tokyo, JapanNippon Institute for Biological Science, 9-2221-1 Shin-machi, Ome 198-0024, Tokyo, JapanNippon Institute for Biological Science, 9-2221-1 Shin-machi, Ome 198-0024, Tokyo, JapanNippon Institute for Biological Science, 9-2221-1 Shin-machi, Ome 198-0024, Tokyo, JapanNippon Institute for Biological Science, 9-2221-1 Shin-machi, Ome 198-0024, Tokyo, JapanNippon Institute for Biological Science, 9-2221-1 Shin-machi, Ome 198-0024, Tokyo, JapanNippon Institute for Biological Science, 9-2221-1 Shin-machi, Ome 198-0024, Tokyo, Japan<i>Erysipelothrix rhusiopathiae</i> causes swine erysipelas (SE). Sporadic SE outbreaks in Japan are mostly caused by the <i>E. rhusiopathiae</i> serovar 1a variant featured by methionine (M) and isoleucine (I) at amino acid positions 203 and 257 of the surface protective antigen (Spa) A protein (M203/I257 SpaA-type). To determine if current vaccines are effective against infection with this variant in pigs, one representative inactivated vaccine, SER-ME (containing <i>E. rhusiopathiae</i> serovar 2a), was evaluated. All vaccinated pigs survived without any apparent clinical signs after lethal challenge with the Fujisawa reference strain or the variant. This indicates that the SER-ME vaccine effectively protects pigs against the infection of <i>E. rhusiopathiae</i> M203/I257 SpaA-type variant. Current vaccines in Japan, including SER-ME, suggest that outbreaks in Japan are unlikely caused by vaccine failure.https://www.mdpi.com/2306-7381/9/8/382<i>Erysipelothrix rhusiopathiae</i>SpaAswine erysipelasvariantvaccine efficacy |
| spellingShingle | Misako Morimoto Atsushi Kato Kotoe Nogami Yuta Akaike Takaaki Furusawa Hiroe Kojima Chihiro Sasakawa The Swine Erysipelas Vaccine SER-ME Effectively Protects Pigs against Challenge with the <i>Erysipelothrix rhusiopathiae</i> M203/I257 SpaA-Type Variant Veterinary Sciences <i>Erysipelothrix rhusiopathiae</i> SpaA swine erysipelas variant vaccine efficacy |
| title | The Swine Erysipelas Vaccine SER-ME Effectively Protects Pigs against Challenge with the <i>Erysipelothrix rhusiopathiae</i> M203/I257 SpaA-Type Variant |
| title_full | The Swine Erysipelas Vaccine SER-ME Effectively Protects Pigs against Challenge with the <i>Erysipelothrix rhusiopathiae</i> M203/I257 SpaA-Type Variant |
| title_fullStr | The Swine Erysipelas Vaccine SER-ME Effectively Protects Pigs against Challenge with the <i>Erysipelothrix rhusiopathiae</i> M203/I257 SpaA-Type Variant |
| title_full_unstemmed | The Swine Erysipelas Vaccine SER-ME Effectively Protects Pigs against Challenge with the <i>Erysipelothrix rhusiopathiae</i> M203/I257 SpaA-Type Variant |
| title_short | The Swine Erysipelas Vaccine SER-ME Effectively Protects Pigs against Challenge with the <i>Erysipelothrix rhusiopathiae</i> M203/I257 SpaA-Type Variant |
| title_sort | swine erysipelas vaccine ser me effectively protects pigs against challenge with the i erysipelothrix rhusiopathiae i m203 i257 spaa type variant |
| topic | <i>Erysipelothrix rhusiopathiae</i> SpaA swine erysipelas variant vaccine efficacy |
| url | https://www.mdpi.com/2306-7381/9/8/382 |
| work_keys_str_mv | AT misakomorimoto theswineerysipelasvaccinesermeeffectivelyprotectspigsagainstchallengewiththeierysipelothrixrhusiopathiaeim203i257spaatypevariant AT atsushikato theswineerysipelasvaccinesermeeffectivelyprotectspigsagainstchallengewiththeierysipelothrixrhusiopathiaeim203i257spaatypevariant AT kotoenogami theswineerysipelasvaccinesermeeffectivelyprotectspigsagainstchallengewiththeierysipelothrixrhusiopathiaeim203i257spaatypevariant AT yutaakaike theswineerysipelasvaccinesermeeffectivelyprotectspigsagainstchallengewiththeierysipelothrixrhusiopathiaeim203i257spaatypevariant AT takaakifurusawa theswineerysipelasvaccinesermeeffectivelyprotectspigsagainstchallengewiththeierysipelothrixrhusiopathiaeim203i257spaatypevariant AT hiroekojima theswineerysipelasvaccinesermeeffectivelyprotectspigsagainstchallengewiththeierysipelothrixrhusiopathiaeim203i257spaatypevariant AT chihirosasakawa theswineerysipelasvaccinesermeeffectivelyprotectspigsagainstchallengewiththeierysipelothrixrhusiopathiaeim203i257spaatypevariant AT misakomorimoto swineerysipelasvaccinesermeeffectivelyprotectspigsagainstchallengewiththeierysipelothrixrhusiopathiaeim203i257spaatypevariant AT atsushikato swineerysipelasvaccinesermeeffectivelyprotectspigsagainstchallengewiththeierysipelothrixrhusiopathiaeim203i257spaatypevariant AT kotoenogami swineerysipelasvaccinesermeeffectivelyprotectspigsagainstchallengewiththeierysipelothrixrhusiopathiaeim203i257spaatypevariant AT yutaakaike swineerysipelasvaccinesermeeffectivelyprotectspigsagainstchallengewiththeierysipelothrixrhusiopathiaeim203i257spaatypevariant AT takaakifurusawa swineerysipelasvaccinesermeeffectivelyprotectspigsagainstchallengewiththeierysipelothrixrhusiopathiaeim203i257spaatypevariant AT hiroekojima swineerysipelasvaccinesermeeffectivelyprotectspigsagainstchallengewiththeierysipelothrixrhusiopathiaeim203i257spaatypevariant AT chihirosasakawa swineerysipelasvaccinesermeeffectivelyprotectspigsagainstchallengewiththeierysipelothrixrhusiopathiaeim203i257spaatypevariant |