The complete mitochondrial genome of Eremias yarkandensis (Reptilia, Squamata, Lacertidae) from Kyrgyzstan
The Yarkand racerunner, Eremias yarkandensis Blandford, 1875, is only distributed in China and Kyrgyzstan. Its complete mitogenome was determined by next-generation sequencing for the first time. The mitogenome was 18,743 bp in length, including 13 protein-coding genes (PCGs), two ribosomal RNA gene...
| Main Authors: | , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Taylor & Francis Group
2022-03-01
|
| Series: | Mitochondrial DNA. Part B. Resources |
| Subjects: | |
| Online Access: | http://dx.doi.org/10.1080/23802359.2022.2047119 |
| _version_ | 1797638623950012416 |
|---|---|
| author | Song Wang Jinlong Liu Marina A. Chirikova Bin Zhang Xianguang Guo |
| author_facet | Song Wang Jinlong Liu Marina A. Chirikova Bin Zhang Xianguang Guo |
| author_sort | Song Wang |
| collection | DOAJ |
| description | The Yarkand racerunner, Eremias yarkandensis Blandford, 1875, is only distributed in China and Kyrgyzstan. Its complete mitogenome was determined by next-generation sequencing for the first time. The mitogenome was 18,743 bp in length, including 13 protein-coding genes (PCGs), two ribosomal RNA genes, 22 transfer RNA genes, and 1 control region. Its gene arrangement was similar to the typical mtDNA of vertebrates. The 13 concatenated PCGs were used to perform Bayesian phylogenetic analyses together with several congeners as well as two representative species of Lacerta with mitogenome data in GenBank. The resulting phylogenetic tree recovered the monophyly of both Eremias and its viviparous group, with E. yarkandensis being more closely related to E. przewalskii than to E. dzungarica. The mitogenome of E. yarkandensis will provide fundamental data for the exploration of the mitogenome evolution in racerunners. |
| first_indexed | 2024-03-11T13:06:15Z |
| format | Article |
| id | doaj.art-239f85123be54c9d93c1cceb49a1c379 |
| institution | Directory Open Access Journal |
| issn | 2380-2359 |
| language | English |
| last_indexed | 2024-03-11T13:06:15Z |
| publishDate | 2022-03-01 |
| publisher | Taylor & Francis Group |
| record_format | Article |
| series | Mitochondrial DNA. Part B. Resources |
| spelling | doaj.art-239f85123be54c9d93c1cceb49a1c3792023-11-03T14:36:02ZengTaylor & Francis GroupMitochondrial DNA. Part B. Resources2380-23592022-03-017344344510.1080/23802359.2022.20471192047119The complete mitochondrial genome of Eremias yarkandensis (Reptilia, Squamata, Lacertidae) from KyrgyzstanSong Wang0Jinlong Liu1Marina A. Chirikova2Bin Zhang3Xianguang Guo4Chengdu Institute of Biology, Chinese Academy of SciencesChengdu Institute of Biology, Chinese Academy of SciencesInstitute of Zoology of Republic of KazakhstanCollege of Life Sciences & Technology, Inner Mongolia Normal UniversityChengdu Institute of Biology, Chinese Academy of SciencesThe Yarkand racerunner, Eremias yarkandensis Blandford, 1875, is only distributed in China and Kyrgyzstan. Its complete mitogenome was determined by next-generation sequencing for the first time. The mitogenome was 18,743 bp in length, including 13 protein-coding genes (PCGs), two ribosomal RNA genes, 22 transfer RNA genes, and 1 control region. Its gene arrangement was similar to the typical mtDNA of vertebrates. The 13 concatenated PCGs were used to perform Bayesian phylogenetic analyses together with several congeners as well as two representative species of Lacerta with mitogenome data in GenBank. The resulting phylogenetic tree recovered the monophyly of both Eremias and its viviparous group, with E. yarkandensis being more closely related to E. przewalskii than to E. dzungarica. The mitogenome of E. yarkandensis will provide fundamental data for the exploration of the mitogenome evolution in racerunners.http://dx.doi.org/10.1080/23802359.2022.2047119kyrgyzstanmitochondrial genomenext-generation sequencingphylogenetic treeeremiasviviparity |
| spellingShingle | Song Wang Jinlong Liu Marina A. Chirikova Bin Zhang Xianguang Guo The complete mitochondrial genome of Eremias yarkandensis (Reptilia, Squamata, Lacertidae) from Kyrgyzstan Mitochondrial DNA. Part B. Resources kyrgyzstan mitochondrial genome next-generation sequencing phylogenetic tree eremias viviparity |
| title | The complete mitochondrial genome of Eremias yarkandensis (Reptilia, Squamata, Lacertidae) from Kyrgyzstan |
| title_full | The complete mitochondrial genome of Eremias yarkandensis (Reptilia, Squamata, Lacertidae) from Kyrgyzstan |
| title_fullStr | The complete mitochondrial genome of Eremias yarkandensis (Reptilia, Squamata, Lacertidae) from Kyrgyzstan |
| title_full_unstemmed | The complete mitochondrial genome of Eremias yarkandensis (Reptilia, Squamata, Lacertidae) from Kyrgyzstan |
| title_short | The complete mitochondrial genome of Eremias yarkandensis (Reptilia, Squamata, Lacertidae) from Kyrgyzstan |
| title_sort | complete mitochondrial genome of eremias yarkandensis reptilia squamata lacertidae from kyrgyzstan |
| topic | kyrgyzstan mitochondrial genome next-generation sequencing phylogenetic tree eremias viviparity |
| url | http://dx.doi.org/10.1080/23802359.2022.2047119 |
| work_keys_str_mv | AT songwang thecompletemitochondrialgenomeoferemiasyarkandensisreptiliasquamatalacertidaefromkyrgyzstan AT jinlongliu thecompletemitochondrialgenomeoferemiasyarkandensisreptiliasquamatalacertidaefromkyrgyzstan AT marinaachirikova thecompletemitochondrialgenomeoferemiasyarkandensisreptiliasquamatalacertidaefromkyrgyzstan AT binzhang thecompletemitochondrialgenomeoferemiasyarkandensisreptiliasquamatalacertidaefromkyrgyzstan AT xianguangguo thecompletemitochondrialgenomeoferemiasyarkandensisreptiliasquamatalacertidaefromkyrgyzstan AT songwang completemitochondrialgenomeoferemiasyarkandensisreptiliasquamatalacertidaefromkyrgyzstan AT jinlongliu completemitochondrialgenomeoferemiasyarkandensisreptiliasquamatalacertidaefromkyrgyzstan AT marinaachirikova completemitochondrialgenomeoferemiasyarkandensisreptiliasquamatalacertidaefromkyrgyzstan AT binzhang completemitochondrialgenomeoferemiasyarkandensisreptiliasquamatalacertidaefromkyrgyzstan AT xianguangguo completemitochondrialgenomeoferemiasyarkandensisreptiliasquamatalacertidaefromkyrgyzstan |