A Novel Candidate Gene Associated With Body Weight in the Pacific White Shrimp Litopenaeus vannamei
Improvements of growth traits are always the focus in selective breeding programs for the Pacific white shrimp Litopenaeus vannamei (L. vannamei). Identification of growth-related genes or markers can contribute to the application of modern breeding technologies, and thus accelerate the genetic impr...
| Main Authors: | , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Frontiers Media S.A.
2019-05-01
|
| Series: | Frontiers in Genetics |
| Subjects: | |
| Online Access: | https://www.frontiersin.org/article/10.3389/fgene.2019.00520/full |
| _version_ | 1828238277978619904 |
|---|---|
| author | Quanchao Wang Yang Yu Yang Yu Qian Zhang Qian Zhang Xiaojun Zhang Xiaojun Zhang Jianbo Yuan Jianbo Yuan Hao Huang Jianhai Xiang Jianhai Xiang Jianhai Xiang Fuhua Li Fuhua Li Fuhua Li |
| author_facet | Quanchao Wang Yang Yu Yang Yu Qian Zhang Qian Zhang Xiaojun Zhang Xiaojun Zhang Jianbo Yuan Jianbo Yuan Hao Huang Jianhai Xiang Jianhai Xiang Jianhai Xiang Fuhua Li Fuhua Li Fuhua Li |
| author_sort | Quanchao Wang |
| collection | DOAJ |
| description | Improvements of growth traits are always the focus in selective breeding programs for the Pacific white shrimp Litopenaeus vannamei (L. vannamei). Identification of growth-related genes or markers can contribute to the application of modern breeding technologies, and thus accelerate the genetic improvement of growth traits. The aim of this study was to identify the genes and molecular markers associated with the growth traits of L. vannamei. A population of 200 individuals was genotyped using 2b-RAD techniques for genome-wide linkage disequilibrium (LD) analysis and genome-wide association study (GWAS). The results showed that the LD decayed fast in the studied population, which suggest that it is feasible to fine map the growth-related genes with GWAS in L. vannamei. One gene designated as LvSRC, encoding the class C scavenger receptor (SRC), was identified as a growth-related candidate gene by GWAS. Further targeted sequencing of the candidate gene in another population of 322 shrimps revealed that several non-synonymous mutations within LvSRC were significantly associated with the body weight (P < 0.01), and the most significant marker (SRC_24) located in the candidate gene could explain 13% of phenotypic variance. The current results provide not only molecular markers for genetic improvement in L. vannamei, but also new insights for understanding the growth regulation mechanism in penaeid shrimp. |
| first_indexed | 2024-04-12T21:01:04Z |
| format | Article |
| id | doaj.art-23d1a8a5c3ce42adba539b9b19069722 |
| institution | Directory Open Access Journal |
| issn | 1664-8021 |
| language | English |
| last_indexed | 2024-04-12T21:01:04Z |
| publishDate | 2019-05-01 |
| publisher | Frontiers Media S.A. |
| record_format | Article |
| series | Frontiers in Genetics |
| spelling | doaj.art-23d1a8a5c3ce42adba539b9b190697222022-12-22T03:16:50ZengFrontiers Media S.A.Frontiers in Genetics1664-80212019-05-011010.3389/fgene.2019.00520434956A Novel Candidate Gene Associated With Body Weight in the Pacific White Shrimp Litopenaeus vannameiQuanchao Wang0Yang Yu1Yang Yu2Qian Zhang3Qian Zhang4Xiaojun Zhang5Xiaojun Zhang6Jianbo Yuan7Jianbo Yuan8Hao Huang9Jianhai Xiang10Jianhai Xiang11Jianhai Xiang12Fuhua Li13Fuhua Li14Fuhua Li15Key Laboratory of Experimental Marine Biology, Institute of Oceanology, Chinese Academy of Sciences, Qingdao, ChinaKey Laboratory of Experimental Marine Biology, Institute of Oceanology, Chinese Academy of Sciences, Qingdao, ChinaLaboratory for Marine Biology and Biotechnology, Qingdao National Laboratory for Marine Science and Technology, Qingdao, ChinaKey Laboratory of Experimental Marine Biology, Institute of Oceanology, Chinese Academy of Sciences, Qingdao, ChinaUniversity of Chinese Academy of Sciences, Beijing, ChinaKey Laboratory of Experimental Marine Biology, Institute of Oceanology, Chinese Academy of Sciences, Qingdao, ChinaLaboratory for Marine Biology and Biotechnology, Qingdao National Laboratory for Marine Science and Technology, Qingdao, ChinaKey Laboratory of Experimental Marine Biology, Institute of Oceanology, Chinese Academy of Sciences, Qingdao, ChinaLaboratory for Marine Biology and Biotechnology, Qingdao National Laboratory for Marine Science and Technology, Qingdao, ChinaHainan Grand Suntop Ocean Breeding Co., Ltd., Wenchang, ChinaKey Laboratory of Experimental Marine Biology, Institute of Oceanology, Chinese Academy of Sciences, Qingdao, ChinaLaboratory for Marine Biology and Biotechnology, Qingdao National Laboratory for Marine Science and Technology, Qingdao, ChinaCenter for Ocean Mega-Science, Chinese Academy of Sciences, Qingdao, ChinaKey Laboratory of Experimental Marine Biology, Institute of Oceanology, Chinese Academy of Sciences, Qingdao, ChinaLaboratory for Marine Biology and Biotechnology, Qingdao National Laboratory for Marine Science and Technology, Qingdao, ChinaCenter for Ocean Mega-Science, Chinese Academy of Sciences, Qingdao, ChinaImprovements of growth traits are always the focus in selective breeding programs for the Pacific white shrimp Litopenaeus vannamei (L. vannamei). Identification of growth-related genes or markers can contribute to the application of modern breeding technologies, and thus accelerate the genetic improvement of growth traits. The aim of this study was to identify the genes and molecular markers associated with the growth traits of L. vannamei. A population of 200 individuals was genotyped using 2b-RAD techniques for genome-wide linkage disequilibrium (LD) analysis and genome-wide association study (GWAS). The results showed that the LD decayed fast in the studied population, which suggest that it is feasible to fine map the growth-related genes with GWAS in L. vannamei. One gene designated as LvSRC, encoding the class C scavenger receptor (SRC), was identified as a growth-related candidate gene by GWAS. Further targeted sequencing of the candidate gene in another population of 322 shrimps revealed that several non-synonymous mutations within LvSRC were significantly associated with the body weight (P < 0.01), and the most significant marker (SRC_24) located in the candidate gene could explain 13% of phenotypic variance. The current results provide not only molecular markers for genetic improvement in L. vannamei, but also new insights for understanding the growth regulation mechanism in penaeid shrimp.https://www.frontiersin.org/article/10.3389/fgene.2019.00520/fullpenaeid shrimpgrowth traitsGWAScandidate geneclass C scavenger receptor |
| spellingShingle | Quanchao Wang Yang Yu Yang Yu Qian Zhang Qian Zhang Xiaojun Zhang Xiaojun Zhang Jianbo Yuan Jianbo Yuan Hao Huang Jianhai Xiang Jianhai Xiang Jianhai Xiang Fuhua Li Fuhua Li Fuhua Li A Novel Candidate Gene Associated With Body Weight in the Pacific White Shrimp Litopenaeus vannamei Frontiers in Genetics penaeid shrimp growth traits GWAS candidate gene class C scavenger receptor |
| title | A Novel Candidate Gene Associated With Body Weight in the Pacific White Shrimp Litopenaeus vannamei |
| title_full | A Novel Candidate Gene Associated With Body Weight in the Pacific White Shrimp Litopenaeus vannamei |
| title_fullStr | A Novel Candidate Gene Associated With Body Weight in the Pacific White Shrimp Litopenaeus vannamei |
| title_full_unstemmed | A Novel Candidate Gene Associated With Body Weight in the Pacific White Shrimp Litopenaeus vannamei |
| title_short | A Novel Candidate Gene Associated With Body Weight in the Pacific White Shrimp Litopenaeus vannamei |
| title_sort | novel candidate gene associated with body weight in the pacific white shrimp litopenaeus vannamei |
| topic | penaeid shrimp growth traits GWAS candidate gene class C scavenger receptor |
| url | https://www.frontiersin.org/article/10.3389/fgene.2019.00520/full |
| work_keys_str_mv | AT quanchaowang anovelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei AT yangyu anovelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei AT yangyu anovelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei AT qianzhang anovelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei AT qianzhang anovelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei AT xiaojunzhang anovelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei AT xiaojunzhang anovelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei AT jianboyuan anovelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei AT jianboyuan anovelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei AT haohuang anovelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei AT jianhaixiang anovelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei AT jianhaixiang anovelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei AT jianhaixiang anovelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei AT fuhuali anovelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei AT fuhuali anovelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei AT fuhuali anovelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei AT quanchaowang novelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei AT yangyu novelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei AT yangyu novelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei AT qianzhang novelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei AT qianzhang novelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei AT xiaojunzhang novelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei AT xiaojunzhang novelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei AT jianboyuan novelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei AT jianboyuan novelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei AT haohuang novelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei AT jianhaixiang novelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei AT jianhaixiang novelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei AT jianhaixiang novelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei AT fuhuali novelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei AT fuhuali novelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei AT fuhuali novelcandidategeneassociatedwithbodyweightinthepacificwhiteshrimplitopenaeusvannamei |