Higher Dietary Vitamin D Intake Influences the Lipid Profile and hs-CRP Concentrations: Cross-Sectional Assessment Based on The National Health and Nutrition Examination Survey
<b>Background.</b> An unanswered question in the field of nutrition is whether there is an association between vitamin D intake and the lipid profile in adults. We conducted this cross-sectional study in order to investigate the impact of vitamin D intake on the lipid profile of adults i...
Κύριοι συγγραφείς: | , , , , , |
---|---|
Μορφή: | Άρθρο |
Γλώσσα: | English |
Έκδοση: |
MDPI AG
2023-02-01
|
Σειρά: | Life |
Θέματα: | |
Διαθέσιμο Online: | https://www.mdpi.com/2075-1729/13/2/581 |
_version_ | 1827756716344737792 |
---|---|
author | Zahra Hariri Hamed Kord-Varkaneh Noura Alyahya Kousalya Prabahar Mihnea-Alexandru Găman Ahmed Abu-Zaid |
author_facet | Zahra Hariri Hamed Kord-Varkaneh Noura Alyahya Kousalya Prabahar Mihnea-Alexandru Găman Ahmed Abu-Zaid |
author_sort | Zahra Hariri |
collection | DOAJ |
description | <b>Background.</b> An unanswered question in the field of nutrition is whether there is an association between vitamin D intake and the lipid profile in adults. We conducted this cross-sectional study in order to investigate the impact of vitamin D intake on the lipid profile of adults in the context of the 2017–2018 National Health and Nutrition Examination Survey (NHANES). <b>Methods.</b> Serum lipids and high-sensitivity C-reactive protein (hs-CRP) concentrations and the Vitamin D intake in 2588 people aged 19 to 70 years was collected using laboratory analysis and 24-h recall, respectively. The one-way ANOVA test was used to compare quantitative variables and the chi-squared test was used to compare qualitative ones. Multivariate logistic regression for three models was performed to assess the odds ratio (OR) of high total cholesterol (TC) (>200 mg/dL), triglycerides (TG) (>150 mg/dL), low-density lipoprotein cholesterol (LDL-C) (>115 mg/dL), high-density lipoprotein cholesterol (HDL-C) (<40 mg/dL) and hs-CRP (>1 mg/l) based on the tertiles of dietary vitamin D (D2 + D3) intake. <b>Results.</b> After adjusting for age, sex, race, body mass index, serum 25-hydroxyvitamin D2, alcohol intake, energy intake, protein intake, carbohydrate intake, fiber intake and fat intake, individuals in the tertile with the highest versus lowest vitamin D intake (>1 mcg/day vs. <0.10 mcg/day) had lower odds of displaying elevated TC, LDL-C and hs-CRP concentrations (OR 0.57; CI: 0.37 to 0.88; P-trend: 0.045, OR 0.59; CI: 0.34 to 1.01; P-trend: 0.025 and OR 0.67; CI: 0.45 to 0.99; P-trend: 0.048, respectively). Based on the results of the logistic regression, no correlation between vitamin D intake and changes in TG or HDL-C values was noted. <b>Conclusions.</b> Our cross-sectional study indicates that higher dietary vitamin D (D2 + D3) intake is associated with lower TC, LDL-C and hs-CRP levels. No relationship between dietary vitamin D intake and TG or HDL-C values was detected. Further large-scale randomized trials are needed to evaluate the actual association between dietary vitamin D intake and the lipid profile. |
first_indexed | 2024-03-11T08:32:14Z |
format | Article |
id | doaj.art-2787d33b79f94e869aa38caa991a3e4c |
institution | Directory Open Access Journal |
issn | 2075-1729 |
language | English |
last_indexed | 2024-03-11T08:32:14Z |
publishDate | 2023-02-01 |
publisher | MDPI AG |
record_format | Article |
series | Life |
spelling | doaj.art-2787d33b79f94e869aa38caa991a3e4c2023-11-16T21:43:15ZengMDPI AGLife2075-17292023-02-0113258110.3390/life13020581Higher Dietary Vitamin D Intake Influences the Lipid Profile and hs-CRP Concentrations: Cross-Sectional Assessment Based on The National Health and Nutrition Examination SurveyZahra Hariri0Hamed Kord-Varkaneh1Noura Alyahya2Kousalya Prabahar3Mihnea-Alexandru Găman4Ahmed Abu-Zaid5Department of Clinical Nutrition and Dietetics, Faculty of Nutrition and Food Technology, National Nutrition and Food Technology Research Institute, Shahid Beheshti University of Medical Sciences, Tehran 19839-63113, IranDepartment of Clinical Nutrition and Dietetics, Faculty of Nutrition and Food Technology, National Nutrition and Food Technology Research Institute, Shahid Beheshti University of Medical Sciences, Tehran 19839-63113, IranCollege of Medicine, Alfaisal University, Riyadh 11533, Saudi ArabiaDepartment of Pharmacy Practice, Faculty of Pharmacy, University of Tabuk, Tabuk 71491, Saudi ArabiaFaculty of Medicine, “Carol Davila” University of Medicine and Pharmacy, 050474 Bucharest, RomaniaCollege of Medicine, Alfaisal University, Riyadh 11533, Saudi Arabia<b>Background.</b> An unanswered question in the field of nutrition is whether there is an association between vitamin D intake and the lipid profile in adults. We conducted this cross-sectional study in order to investigate the impact of vitamin D intake on the lipid profile of adults in the context of the 2017–2018 National Health and Nutrition Examination Survey (NHANES). <b>Methods.</b> Serum lipids and high-sensitivity C-reactive protein (hs-CRP) concentrations and the Vitamin D intake in 2588 people aged 19 to 70 years was collected using laboratory analysis and 24-h recall, respectively. The one-way ANOVA test was used to compare quantitative variables and the chi-squared test was used to compare qualitative ones. Multivariate logistic regression for three models was performed to assess the odds ratio (OR) of high total cholesterol (TC) (>200 mg/dL), triglycerides (TG) (>150 mg/dL), low-density lipoprotein cholesterol (LDL-C) (>115 mg/dL), high-density lipoprotein cholesterol (HDL-C) (<40 mg/dL) and hs-CRP (>1 mg/l) based on the tertiles of dietary vitamin D (D2 + D3) intake. <b>Results.</b> After adjusting for age, sex, race, body mass index, serum 25-hydroxyvitamin D2, alcohol intake, energy intake, protein intake, carbohydrate intake, fiber intake and fat intake, individuals in the tertile with the highest versus lowest vitamin D intake (>1 mcg/day vs. <0.10 mcg/day) had lower odds of displaying elevated TC, LDL-C and hs-CRP concentrations (OR 0.57; CI: 0.37 to 0.88; P-trend: 0.045, OR 0.59; CI: 0.34 to 1.01; P-trend: 0.025 and OR 0.67; CI: 0.45 to 0.99; P-trend: 0.048, respectively). Based on the results of the logistic regression, no correlation between vitamin D intake and changes in TG or HDL-C values was noted. <b>Conclusions.</b> Our cross-sectional study indicates that higher dietary vitamin D (D2 + D3) intake is associated with lower TC, LDL-C and hs-CRP levels. No relationship between dietary vitamin D intake and TG or HDL-C values was detected. Further large-scale randomized trials are needed to evaluate the actual association between dietary vitamin D intake and the lipid profile.https://www.mdpi.com/2075-1729/13/2/581vitamin Dlipid profiletriglyceridestotal cholesterolLDL-CHDL-C |
spellingShingle | Zahra Hariri Hamed Kord-Varkaneh Noura Alyahya Kousalya Prabahar Mihnea-Alexandru Găman Ahmed Abu-Zaid Higher Dietary Vitamin D Intake Influences the Lipid Profile and hs-CRP Concentrations: Cross-Sectional Assessment Based on The National Health and Nutrition Examination Survey Life vitamin D lipid profile triglycerides total cholesterol LDL-C HDL-C |
title | Higher Dietary Vitamin D Intake Influences the Lipid Profile and hs-CRP Concentrations: Cross-Sectional Assessment Based on The National Health and Nutrition Examination Survey |
title_full | Higher Dietary Vitamin D Intake Influences the Lipid Profile and hs-CRP Concentrations: Cross-Sectional Assessment Based on The National Health and Nutrition Examination Survey |
title_fullStr | Higher Dietary Vitamin D Intake Influences the Lipid Profile and hs-CRP Concentrations: Cross-Sectional Assessment Based on The National Health and Nutrition Examination Survey |
title_full_unstemmed | Higher Dietary Vitamin D Intake Influences the Lipid Profile and hs-CRP Concentrations: Cross-Sectional Assessment Based on The National Health and Nutrition Examination Survey |
title_short | Higher Dietary Vitamin D Intake Influences the Lipid Profile and hs-CRP Concentrations: Cross-Sectional Assessment Based on The National Health and Nutrition Examination Survey |
title_sort | higher dietary vitamin d intake influences the lipid profile and hs crp concentrations cross sectional assessment based on the national health and nutrition examination survey |
topic | vitamin D lipid profile triglycerides total cholesterol LDL-C HDL-C |
url | https://www.mdpi.com/2075-1729/13/2/581 |
work_keys_str_mv | AT zahrahariri higherdietaryvitamindintakeinfluencesthelipidprofileandhscrpconcentrationscrosssectionalassessmentbasedonthenationalhealthandnutritionexaminationsurvey AT hamedkordvarkaneh higherdietaryvitamindintakeinfluencesthelipidprofileandhscrpconcentrationscrosssectionalassessmentbasedonthenationalhealthandnutritionexaminationsurvey AT nouraalyahya higherdietaryvitamindintakeinfluencesthelipidprofileandhscrpconcentrationscrosssectionalassessmentbasedonthenationalhealthandnutritionexaminationsurvey AT kousalyaprabahar higherdietaryvitamindintakeinfluencesthelipidprofileandhscrpconcentrationscrosssectionalassessmentbasedonthenationalhealthandnutritionexaminationsurvey AT mihneaalexandrugaman higherdietaryvitamindintakeinfluencesthelipidprofileandhscrpconcentrationscrosssectionalassessmentbasedonthenationalhealthandnutritionexaminationsurvey AT ahmedabuzaid higherdietaryvitamindintakeinfluencesthelipidprofileandhscrpconcentrationscrosssectionalassessmentbasedonthenationalhealthandnutritionexaminationsurvey |