All Polymer Dielectric Films for Achieving High Energy Density Film Capacitors by Blending Poly(Vinylidene Fluoride-Trifluoroethylene-Chlorofluoroethylene) with Aromatic Polythiourea
Abstract Construct dielectric films with high energy density and efficiency are the key factor to fabricate high-performance dielectric film capacitors. In this paper, an all organic composite film was constructed based on high dielectric polymer and linear dielectric polymer. After the optimized po...
| Main Authors: | , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
SpringerOpen
2020-02-01
|
| Series: | Nanoscale Research Letters |
| Subjects: | |
| Online Access: | https://doi.org/10.1186/s11671-020-3270-x |
| _version_ | 1797706635125194752 |
|---|---|
| author | Chengwei Li Liuwei Shi Wenyao Yang Yujiu Zhou Xiali Li Chengguang Zhang Yajie Yang |
| author_facet | Chengwei Li Liuwei Shi Wenyao Yang Yujiu Zhou Xiali Li Chengguang Zhang Yajie Yang |
| author_sort | Chengwei Li |
| collection | DOAJ |
| description | Abstract Construct dielectric films with high energy density and efficiency are the key factor to fabricate high-performance dielectric film capacitors. In this paper, an all organic composite film was constructed based on high dielectric polymer and linear dielectric polymer. After the optimized polycondensation reaction of a linear dielectric polymer aromatic polythiourea (ArPTU), the proper molecular weight ArPTU was obtained, which was introduced into poly(vinylidene fluoride-trifluoroethylene-chlorofluoroethylene) (PVDF-TrFE-CFE) terpolymer for a composite dielectrics. The results indicate that the addition of ArPTU molecules reduces the dielectric loss and improves the breakdown field strength of the PVDF-TrFE-CFE effectively. For the PVDF-TrFE-CFE/ArPTU (90/10) composite film, the maximum energy density about 22.06 J/cm3 at 407.57 MV/m was achieved, and high discharge efficiency about 72% was presented. This composite material can be casted on flexible substrate easily, and PVDF-TrFE-CFE/ArPTU organic composite films having high energy density, high breakdown field strength, low dielectric loss, and higher discharge efficiency are obtained. This is an unreported exploration about high energy density organic dielectric films based on PVDF-TrFE-CFE matrix and linear polymer dielectrics, and the findings of this research can provide a simple and scalable method for producing flexible high energy density materials for energy storage devices. |
| first_indexed | 2024-03-12T05:54:14Z |
| format | Article |
| id | doaj.art-27ce76ef33214f1b83b75242d55bf5a3 |
| institution | Directory Open Access Journal |
| issn | 1931-7573 1556-276X |
| language | English |
| last_indexed | 2024-03-12T05:54:14Z |
| publishDate | 2020-02-01 |
| publisher | SpringerOpen |
| record_format | Article |
| series | Nanoscale Research Letters |
| spelling | doaj.art-27ce76ef33214f1b83b75242d55bf5a32023-09-03T04:46:18ZengSpringerOpenNanoscale Research Letters1931-75731556-276X2020-02-011511910.1186/s11671-020-3270-xAll Polymer Dielectric Films for Achieving High Energy Density Film Capacitors by Blending Poly(Vinylidene Fluoride-Trifluoroethylene-Chlorofluoroethylene) with Aromatic PolythioureaChengwei Li0Liuwei Shi1Wenyao Yang2Yujiu Zhou3Xiali Li4Chengguang Zhang5Yajie Yang6State Key Laboratory of Electronic Thin Films and Integrated Devices, School of Optoelectronic Science and Engineering, University of Electronic Science and Technology of ChinaState Key Laboratory of Electronic Thin Films and Integrated Devices, School of Optoelectronic Science and Engineering, University of Electronic Science and Technology of ChinaChongqing Engineering Research Center of New Energy Storage Devices and Applications, Chongqing University of Arts and SciencesState Key Laboratory of Electronic Thin Films and Integrated Devices, School of Optoelectronic Science and Engineering, University of Electronic Science and Technology of ChinaState Key Laboratory of Electronic Thin Films and Integrated Devices, School of Optoelectronic Science and Engineering, University of Electronic Science and Technology of ChinaState Key Laboratory of Electronic Thin Films and Integrated Devices, School of Optoelectronic Science and Engineering, University of Electronic Science and Technology of ChinaState Key Laboratory of Electronic Thin Films and Integrated Devices, School of Optoelectronic Science and Engineering, University of Electronic Science and Technology of ChinaAbstract Construct dielectric films with high energy density and efficiency are the key factor to fabricate high-performance dielectric film capacitors. In this paper, an all organic composite film was constructed based on high dielectric polymer and linear dielectric polymer. After the optimized polycondensation reaction of a linear dielectric polymer aromatic polythiourea (ArPTU), the proper molecular weight ArPTU was obtained, which was introduced into poly(vinylidene fluoride-trifluoroethylene-chlorofluoroethylene) (PVDF-TrFE-CFE) terpolymer for a composite dielectrics. The results indicate that the addition of ArPTU molecules reduces the dielectric loss and improves the breakdown field strength of the PVDF-TrFE-CFE effectively. For the PVDF-TrFE-CFE/ArPTU (90/10) composite film, the maximum energy density about 22.06 J/cm3 at 407.57 MV/m was achieved, and high discharge efficiency about 72% was presented. This composite material can be casted on flexible substrate easily, and PVDF-TrFE-CFE/ArPTU organic composite films having high energy density, high breakdown field strength, low dielectric loss, and higher discharge efficiency are obtained. This is an unreported exploration about high energy density organic dielectric films based on PVDF-TrFE-CFE matrix and linear polymer dielectrics, and the findings of this research can provide a simple and scalable method for producing flexible high energy density materials for energy storage devices.https://doi.org/10.1186/s11671-020-3270-xAromatic polythioureaComposite filmsEnergy storage densityMolecular weightPoly(vinylidene fluoride-trifluoroethylene-chlorofluoroethylene) |
| spellingShingle | Chengwei Li Liuwei Shi Wenyao Yang Yujiu Zhou Xiali Li Chengguang Zhang Yajie Yang All Polymer Dielectric Films for Achieving High Energy Density Film Capacitors by Blending Poly(Vinylidene Fluoride-Trifluoroethylene-Chlorofluoroethylene) with Aromatic Polythiourea Nanoscale Research Letters Aromatic polythiourea Composite films Energy storage density Molecular weight Poly(vinylidene fluoride-trifluoroethylene-chlorofluoroethylene) |
| title | All Polymer Dielectric Films for Achieving High Energy Density Film Capacitors by Blending Poly(Vinylidene Fluoride-Trifluoroethylene-Chlorofluoroethylene) with Aromatic Polythiourea |
| title_full | All Polymer Dielectric Films for Achieving High Energy Density Film Capacitors by Blending Poly(Vinylidene Fluoride-Trifluoroethylene-Chlorofluoroethylene) with Aromatic Polythiourea |
| title_fullStr | All Polymer Dielectric Films for Achieving High Energy Density Film Capacitors by Blending Poly(Vinylidene Fluoride-Trifluoroethylene-Chlorofluoroethylene) with Aromatic Polythiourea |
| title_full_unstemmed | All Polymer Dielectric Films for Achieving High Energy Density Film Capacitors by Blending Poly(Vinylidene Fluoride-Trifluoroethylene-Chlorofluoroethylene) with Aromatic Polythiourea |
| title_short | All Polymer Dielectric Films for Achieving High Energy Density Film Capacitors by Blending Poly(Vinylidene Fluoride-Trifluoroethylene-Chlorofluoroethylene) with Aromatic Polythiourea |
| title_sort | all polymer dielectric films for achieving high energy density film capacitors by blending poly vinylidene fluoride trifluoroethylene chlorofluoroethylene with aromatic polythiourea |
| topic | Aromatic polythiourea Composite films Energy storage density Molecular weight Poly(vinylidene fluoride-trifluoroethylene-chlorofluoroethylene) |
| url | https://doi.org/10.1186/s11671-020-3270-x |
| work_keys_str_mv | AT chengweili allpolymerdielectricfilmsforachievinghighenergydensityfilmcapacitorsbyblendingpolyvinylidenefluoridetrifluoroethylenechlorofluoroethylenewitharomaticpolythiourea AT liuweishi allpolymerdielectricfilmsforachievinghighenergydensityfilmcapacitorsbyblendingpolyvinylidenefluoridetrifluoroethylenechlorofluoroethylenewitharomaticpolythiourea AT wenyaoyang allpolymerdielectricfilmsforachievinghighenergydensityfilmcapacitorsbyblendingpolyvinylidenefluoridetrifluoroethylenechlorofluoroethylenewitharomaticpolythiourea AT yujiuzhou allpolymerdielectricfilmsforachievinghighenergydensityfilmcapacitorsbyblendingpolyvinylidenefluoridetrifluoroethylenechlorofluoroethylenewitharomaticpolythiourea AT xialili allpolymerdielectricfilmsforachievinghighenergydensityfilmcapacitorsbyblendingpolyvinylidenefluoridetrifluoroethylenechlorofluoroethylenewitharomaticpolythiourea AT chengguangzhang allpolymerdielectricfilmsforachievinghighenergydensityfilmcapacitorsbyblendingpolyvinylidenefluoridetrifluoroethylenechlorofluoroethylenewitharomaticpolythiourea AT yajieyang allpolymerdielectricfilmsforachievinghighenergydensityfilmcapacitorsbyblendingpolyvinylidenefluoridetrifluoroethylenechlorofluoroethylenewitharomaticpolythiourea |