Progress in research on m6A modification of FTO mediated-RNA and development
Human fat mass and obesity associated protein FTO is the first confirmed N6-methyladenosine(m6A) demethylase, which demonstrated the existence of reversible RNA modification, and also unveiled the prelude of m6A modification research. More and more researchers have tried to explore the specific mech...
| Main Author: | |
|---|---|
| Format: | Article |
| Language: | zho |
| Published: |
Institute of Basic Medical Sciences and Peking Union Medical College Hospital, Chinese Academy of Medical Sciences / Peking Union Medical College.
2022-10-01
|
| Series: | Jichu yixue yu linchuang |
| Subjects: | |
| Online Access: | http://journal11.magtechjournal.com/Jwk_jcyxylc/fileup/1001-6325/PDF/1001-6325-2022-42-10-1591.pdf |
| _version_ | 1827390635684921344 |
|---|---|
| author | PAN Ming-min, WANG Qi-yang, YANG Li-ping |
| author_facet | PAN Ming-min, WANG Qi-yang, YANG Li-ping |
| author_sort | PAN Ming-min, WANG Qi-yang, YANG Li-ping |
| collection | DOAJ |
| description | Human fat mass and obesity associated protein FTO is the first confirmed N6-methyladenosine(m6A) demethylase, which demonstrated the existence of reversible RNA modification, and also unveiled the prelude of m6A modification research. More and more researchers have tried to explore the specific mechanism of gene expression regulation at the level of m6A modification. It is found that m6A modification function requires the joint participation of methylesterase, demethylase, and binding protein to complete. FTO catalyze the demethylation of m6A modifications on mRNAs and is widely expressed in human tissues and participate in the regulation of various biological processes. This paper outlines the relationship between demethylase FTO and its mediated m6A/RNA modification and the development of body fat tissue, embryonic tissue, brain and neuro-system, hoping to gain insight into the function and mechanism of FTO. |
| first_indexed | 2024-03-08T16:54:41Z |
| format | Article |
| id | doaj.art-29b15303d27d41dcbf621797f8a09e47 |
| institution | Directory Open Access Journal |
| issn | 1001-6325 |
| language | zho |
| last_indexed | 2024-03-08T16:54:41Z |
| publishDate | 2022-10-01 |
| publisher | Institute of Basic Medical Sciences and Peking Union Medical College Hospital, Chinese Academy of Medical Sciences / Peking Union Medical College. |
| record_format | Article |
| series | Jichu yixue yu linchuang |
| spelling | doaj.art-29b15303d27d41dcbf621797f8a09e472024-01-05T02:36:29ZzhoInstitute of Basic Medical Sciences and Peking Union Medical College Hospital, Chinese Academy of Medical Sciences / Peking Union Medical College.Jichu yixue yu linchuang1001-63252022-10-0142101591159510.16352/j.issn.1001-6325.2022.10.1591Progress in research on m6A modification of FTO mediated-RNA and developmentPAN Ming-min, WANG Qi-yang, YANG Li-ping0Department of Integrated Chinese and Western Medicine, Henan University of Chinese Medicine, Zhengzhou 450046,ChinaHuman fat mass and obesity associated protein FTO is the first confirmed N6-methyladenosine(m6A) demethylase, which demonstrated the existence of reversible RNA modification, and also unveiled the prelude of m6A modification research. More and more researchers have tried to explore the specific mechanism of gene expression regulation at the level of m6A modification. It is found that m6A modification function requires the joint participation of methylesterase, demethylase, and binding protein to complete. FTO catalyze the demethylation of m6A modifications on mRNAs and is widely expressed in human tissues and participate in the regulation of various biological processes. This paper outlines the relationship between demethylase FTO and its mediated m6A/RNA modification and the development of body fat tissue, embryonic tissue, brain and neuro-system, hoping to gain insight into the function and mechanism of FTO.http://journal11.magtechjournal.com/Jwk_jcyxylc/fileup/1001-6325/PDF/1001-6325-2022-42-10-1591.pdffto|mrna|m6a|development |
| spellingShingle | PAN Ming-min, WANG Qi-yang, YANG Li-ping Progress in research on m6A modification of FTO mediated-RNA and development Jichu yixue yu linchuang fto|mrna|m6a|development |
| title | Progress in research on m6A modification of FTO mediated-RNA and development |
| title_full | Progress in research on m6A modification of FTO mediated-RNA and development |
| title_fullStr | Progress in research on m6A modification of FTO mediated-RNA and development |
| title_full_unstemmed | Progress in research on m6A modification of FTO mediated-RNA and development |
| title_short | Progress in research on m6A modification of FTO mediated-RNA and development |
| title_sort | progress in research on m6a modification of fto mediated rna and development |
| topic | fto|mrna|m6a|development |
| url | http://journal11.magtechjournal.com/Jwk_jcyxylc/fileup/1001-6325/PDF/1001-6325-2022-42-10-1591.pdf |
| work_keys_str_mv | AT panmingminwangqiyangyangliping progressinresearchonm6amodificationofftomediatedrnaanddevelopment |