Identification and evaluation in-vitro of conserved peptides with high affinity to MHC-I as potential protective epitopes for Newcastle disease virus vaccines
Abstract Background Newcastle disease (ND) is a major threat to the poultry industry, leading to significant economic losses. The current ND vaccines, usually based on active or attenuated strains, are only partially effective and can cause adverse effects post-vaccination. Therefore, the developmen...
| Main Authors: | , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
BMC
2023-10-01
|
| Series: | BMC Veterinary Research |
| Subjects: | |
| Online Access: | https://doi.org/10.1186/s12917-023-03726-w |
| _version_ | 1797452222539235328 |
|---|---|
| author | Luis Tataje-Lavanda Edith Málaga Manuela Verastegui Egma Mayta Huatuco Eliana Icochea Manolo Fernández-Díaz Mirko Zimic |
| author_facet | Luis Tataje-Lavanda Edith Málaga Manuela Verastegui Egma Mayta Huatuco Eliana Icochea Manolo Fernández-Díaz Mirko Zimic |
| author_sort | Luis Tataje-Lavanda |
| collection | DOAJ |
| description | Abstract Background Newcastle disease (ND) is a major threat to the poultry industry, leading to significant economic losses. The current ND vaccines, usually based on active or attenuated strains, are only partially effective and can cause adverse effects post-vaccination. Therefore, the development of safer and more efficient vaccines is necessary. Epitopes represent the antigenic portion of the pathogen and their identification and use for immunization could lead to safer and more effective vaccines. However, the prediction of protective epitopes for a pathogen is a major challenge, especially taking into account the immune system of the target species. Results In this study, we utilized an artificial intelligence algorithm to predict ND virus (NDV) peptides that exhibit high affinity to the chicken MHC-I complex. We selected the peptides that are conserved across different NDV genotypes and absent in the chicken proteome. From the filtered peptides, we synthesized the five peptides with the highest affinities for the L, HN, and F proteins of NDV. We evaluated these peptides in-vitro for their ability to elicit cell-mediated immunity, which was measured by the lymphocyte proliferation in spleen cells of chickens previously immunized with NDV. Conclusions Our study identified five peptides with high affinity to MHC-I that have the potential to serve as protective epitopes and could be utilized for the development of multi-epitope NDV vaccines. This approach can provide a safer and more efficient method for NDV immunization. |
| first_indexed | 2024-03-09T15:05:40Z |
| format | Article |
| id | doaj.art-2fd85235e8b542c8826040cdd52fdfe0 |
| institution | Directory Open Access Journal |
| issn | 1746-6148 |
| language | English |
| last_indexed | 2024-03-09T15:05:40Z |
| publishDate | 2023-10-01 |
| publisher | BMC |
| record_format | Article |
| series | BMC Veterinary Research |
| spelling | doaj.art-2fd85235e8b542c8826040cdd52fdfe02023-11-26T13:38:37ZengBMCBMC Veterinary Research1746-61482023-10-011911710.1186/s12917-023-03726-wIdentification and evaluation in-vitro of conserved peptides with high affinity to MHC-I as potential protective epitopes for Newcastle disease virus vaccinesLuis Tataje-Lavanda0Edith Málaga1Manuela Verastegui2Egma Mayta Huatuco3Eliana Icochea4Manolo Fernández-Díaz5Mirko Zimic6Research and Development Laboratories, FARVET SACResearch Laboratory On Infectious Diseases, Cayetano Heredia Peruvian UniversityResearch Laboratory On Infectious Diseases, Cayetano Heredia Peruvian UniversityLaboratory of Clinical Molecular Virology, Faculty of Biological Sciences, National University of San MarcosAvian Pathology Laboratory, Faculty of Veterinary Medicine, National University of San MarcosResearch and Development Laboratories, FARVET SACResearch and Development Laboratories, FARVET SACAbstract Background Newcastle disease (ND) is a major threat to the poultry industry, leading to significant economic losses. The current ND vaccines, usually based on active or attenuated strains, are only partially effective and can cause adverse effects post-vaccination. Therefore, the development of safer and more efficient vaccines is necessary. Epitopes represent the antigenic portion of the pathogen and their identification and use for immunization could lead to safer and more effective vaccines. However, the prediction of protective epitopes for a pathogen is a major challenge, especially taking into account the immune system of the target species. Results In this study, we utilized an artificial intelligence algorithm to predict ND virus (NDV) peptides that exhibit high affinity to the chicken MHC-I complex. We selected the peptides that are conserved across different NDV genotypes and absent in the chicken proteome. From the filtered peptides, we synthesized the five peptides with the highest affinities for the L, HN, and F proteins of NDV. We evaluated these peptides in-vitro for their ability to elicit cell-mediated immunity, which was measured by the lymphocyte proliferation in spleen cells of chickens previously immunized with NDV. Conclusions Our study identified five peptides with high affinity to MHC-I that have the potential to serve as protective epitopes and could be utilized for the development of multi-epitope NDV vaccines. This approach can provide a safer and more efficient method for NDV immunization.https://doi.org/10.1186/s12917-023-03726-wEpitopeFusionHemagglutinin-neuraminidaseNewcastle disease virusPeptide-based vaccinePolymerase |
| spellingShingle | Luis Tataje-Lavanda Edith Málaga Manuela Verastegui Egma Mayta Huatuco Eliana Icochea Manolo Fernández-Díaz Mirko Zimic Identification and evaluation in-vitro of conserved peptides with high affinity to MHC-I as potential protective epitopes for Newcastle disease virus vaccines BMC Veterinary Research Epitope Fusion Hemagglutinin-neuraminidase Newcastle disease virus Peptide-based vaccine Polymerase |
| title | Identification and evaluation in-vitro of conserved peptides with high affinity to MHC-I as potential protective epitopes for Newcastle disease virus vaccines |
| title_full | Identification and evaluation in-vitro of conserved peptides with high affinity to MHC-I as potential protective epitopes for Newcastle disease virus vaccines |
| title_fullStr | Identification and evaluation in-vitro of conserved peptides with high affinity to MHC-I as potential protective epitopes for Newcastle disease virus vaccines |
| title_full_unstemmed | Identification and evaluation in-vitro of conserved peptides with high affinity to MHC-I as potential protective epitopes for Newcastle disease virus vaccines |
| title_short | Identification and evaluation in-vitro of conserved peptides with high affinity to MHC-I as potential protective epitopes for Newcastle disease virus vaccines |
| title_sort | identification and evaluation in vitro of conserved peptides with high affinity to mhc i as potential protective epitopes for newcastle disease virus vaccines |
| topic | Epitope Fusion Hemagglutinin-neuraminidase Newcastle disease virus Peptide-based vaccine Polymerase |
| url | https://doi.org/10.1186/s12917-023-03726-w |
| work_keys_str_mv | AT luistatajelavanda identificationandevaluationinvitroofconservedpeptideswithhighaffinitytomhciaspotentialprotectiveepitopesfornewcastlediseasevirusvaccines AT edithmalaga identificationandevaluationinvitroofconservedpeptideswithhighaffinitytomhciaspotentialprotectiveepitopesfornewcastlediseasevirusvaccines AT manuelaverastegui identificationandevaluationinvitroofconservedpeptideswithhighaffinitytomhciaspotentialprotectiveepitopesfornewcastlediseasevirusvaccines AT egmamaytahuatuco identificationandevaluationinvitroofconservedpeptideswithhighaffinitytomhciaspotentialprotectiveepitopesfornewcastlediseasevirusvaccines AT elianaicochea identificationandevaluationinvitroofconservedpeptideswithhighaffinitytomhciaspotentialprotectiveepitopesfornewcastlediseasevirusvaccines AT manolofernandezdiaz identificationandevaluationinvitroofconservedpeptideswithhighaffinitytomhciaspotentialprotectiveepitopesfornewcastlediseasevirusvaccines AT mirkozimic identificationandevaluationinvitroofconservedpeptideswithhighaffinitytomhciaspotentialprotectiveepitopesfornewcastlediseasevirusvaccines |