Identification of Five Tumor Antigens for Development and Two Immune Subtypes for Personalized Medicine of mRNA Vaccines in Papillary Renal Cell Carcinoma
Increasing evidence has revealed the promise of mRNA-type cancer vaccines as a new direction for cancer immune treatment in several solid tumors, however, its application in papillary renal cell carcinoma (PRCC) remains unclear. The purpose of this study was to identify potential tumor antigens and...
| Main Authors: | , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
MDPI AG
2023-02-01
|
| Series: | Journal of Personalized Medicine |
| Subjects: | |
| Online Access: | https://www.mdpi.com/2075-4426/13/2/359 |
| _version_ | 1797619953143119872 |
|---|---|
| author | Jianpei Hu Zhongze Yuan Yifen Jiang Zengnan Mo |
| author_facet | Jianpei Hu Zhongze Yuan Yifen Jiang Zengnan Mo |
| author_sort | Jianpei Hu |
| collection | DOAJ |
| description | Increasing evidence has revealed the promise of mRNA-type cancer vaccines as a new direction for cancer immune treatment in several solid tumors, however, its application in papillary renal cell carcinoma (PRCC) remains unclear. The purpose of this study was to identify potential tumor antigens and robust immune subtypes for the development and appropriate use of anti-PRCC mRNA vaccines, respectively. Raw sequencing data and clinical information of PRCC patients were downloaded from The Cancer Genome Atlas (TCGA) database. The cBioPortal was utilized for the visualization and comparison of genetic alterations. The TIMER was used to assess the correlation between preliminary tumor antigens and the abundance of infiltrated antigen presenting cells (APCs). Immune subtypes were determined by the consensus clustering algorithm, and clinical and molecular discrepancies were further explored for a deeper understanding of immune subtypes. Five tumor antigens, including ALOX15B, HS3ST2, PIGR, ZMYND15 and LIMK1, were identified for PRCC, which were correlated with patients’ prognoses and infiltration levels of APCs. Two immune subtypes (IS1 and IS2) were disclosed with obviously distinct clinical and molecular characteristics. Compared with IS2, IS1 exhibited a significantly immune-suppressive phenotype, which largely weakened the efficacy of the mRNA vaccine. Overall, our study provides some insights for the design of anti-PRCC mRNA vaccines and, more importantly, the selection of suitable patients to be vaccinated. |
| first_indexed | 2024-03-11T08:34:21Z |
| format | Article |
| id | doaj.art-305b441e59f24a63931052bdc8323c29 |
| institution | Directory Open Access Journal |
| issn | 2075-4426 |
| language | English |
| last_indexed | 2024-03-11T08:34:21Z |
| publishDate | 2023-02-01 |
| publisher | MDPI AG |
| record_format | Article |
| series | Journal of Personalized Medicine |
| spelling | doaj.art-305b441e59f24a63931052bdc8323c292023-11-16T21:34:19ZengMDPI AGJournal of Personalized Medicine2075-44262023-02-0113235910.3390/jpm13020359Identification of Five Tumor Antigens for Development and Two Immune Subtypes for Personalized Medicine of mRNA Vaccines in Papillary Renal Cell CarcinomaJianpei Hu0Zhongze Yuan1Yifen Jiang2Zengnan Mo3Center for Genomic and Personalized Medicine, Guangxi Key Laboratory for Genomic and Personalized Medicine, Guangxi Collaborative Innovation Center for Genomic and Personalized Medicine, Guangxi Medical University, Nanning 530021, ChinaCenter for Genomic and Personalized Medicine, Guangxi Key Laboratory for Genomic and Personalized Medicine, Guangxi Collaborative Innovation Center for Genomic and Personalized Medicine, Guangxi Medical University, Nanning 530021, ChinaDepartment of Medical Record Management Center, The People’s Hospital of Yubei District of Chongqing City, Chongqing 401120, ChinaCenter for Genomic and Personalized Medicine, Guangxi Key Laboratory for Genomic and Personalized Medicine, Guangxi Collaborative Innovation Center for Genomic and Personalized Medicine, Guangxi Medical University, Nanning 530021, ChinaIncreasing evidence has revealed the promise of mRNA-type cancer vaccines as a new direction for cancer immune treatment in several solid tumors, however, its application in papillary renal cell carcinoma (PRCC) remains unclear. The purpose of this study was to identify potential tumor antigens and robust immune subtypes for the development and appropriate use of anti-PRCC mRNA vaccines, respectively. Raw sequencing data and clinical information of PRCC patients were downloaded from The Cancer Genome Atlas (TCGA) database. The cBioPortal was utilized for the visualization and comparison of genetic alterations. The TIMER was used to assess the correlation between preliminary tumor antigens and the abundance of infiltrated antigen presenting cells (APCs). Immune subtypes were determined by the consensus clustering algorithm, and clinical and molecular discrepancies were further explored for a deeper understanding of immune subtypes. Five tumor antigens, including ALOX15B, HS3ST2, PIGR, ZMYND15 and LIMK1, were identified for PRCC, which were correlated with patients’ prognoses and infiltration levels of APCs. Two immune subtypes (IS1 and IS2) were disclosed with obviously distinct clinical and molecular characteristics. Compared with IS2, IS1 exhibited a significantly immune-suppressive phenotype, which largely weakened the efficacy of the mRNA vaccine. Overall, our study provides some insights for the design of anti-PRCC mRNA vaccines and, more importantly, the selection of suitable patients to be vaccinated.https://www.mdpi.com/2075-4426/13/2/359papillary renal cell carcinomatumor antigensmRNA vaccineimmune landscapepersonalized medicine |
| spellingShingle | Jianpei Hu Zhongze Yuan Yifen Jiang Zengnan Mo Identification of Five Tumor Antigens for Development and Two Immune Subtypes for Personalized Medicine of mRNA Vaccines in Papillary Renal Cell Carcinoma Journal of Personalized Medicine papillary renal cell carcinoma tumor antigens mRNA vaccine immune landscape personalized medicine |
| title | Identification of Five Tumor Antigens for Development and Two Immune Subtypes for Personalized Medicine of mRNA Vaccines in Papillary Renal Cell Carcinoma |
| title_full | Identification of Five Tumor Antigens for Development and Two Immune Subtypes for Personalized Medicine of mRNA Vaccines in Papillary Renal Cell Carcinoma |
| title_fullStr | Identification of Five Tumor Antigens for Development and Two Immune Subtypes for Personalized Medicine of mRNA Vaccines in Papillary Renal Cell Carcinoma |
| title_full_unstemmed | Identification of Five Tumor Antigens for Development and Two Immune Subtypes for Personalized Medicine of mRNA Vaccines in Papillary Renal Cell Carcinoma |
| title_short | Identification of Five Tumor Antigens for Development and Two Immune Subtypes for Personalized Medicine of mRNA Vaccines in Papillary Renal Cell Carcinoma |
| title_sort | identification of five tumor antigens for development and two immune subtypes for personalized medicine of mrna vaccines in papillary renal cell carcinoma |
| topic | papillary renal cell carcinoma tumor antigens mRNA vaccine immune landscape personalized medicine |
| url | https://www.mdpi.com/2075-4426/13/2/359 |
| work_keys_str_mv | AT jianpeihu identificationoffivetumorantigensfordevelopmentandtwoimmunesubtypesforpersonalizedmedicineofmrnavaccinesinpapillaryrenalcellcarcinoma AT zhongzeyuan identificationoffivetumorantigensfordevelopmentandtwoimmunesubtypesforpersonalizedmedicineofmrnavaccinesinpapillaryrenalcellcarcinoma AT yifenjiang identificationoffivetumorantigensfordevelopmentandtwoimmunesubtypesforpersonalizedmedicineofmrnavaccinesinpapillaryrenalcellcarcinoma AT zengnanmo identificationoffivetumorantigensfordevelopmentandtwoimmunesubtypesforpersonalizedmedicineofmrnavaccinesinpapillaryrenalcellcarcinoma |