Measurement-driven large-eddy simulations of a diurnal cycle during a wake-steering field campaign
<p>High-fidelity flow modeling with data assimilation enables accurate representation of the wind farm operating environment under realistic, nonstationary atmospheric conditions. Capturing the temporal evolution of the turbulent atmospheric boundary layer is critical to understanding the beha...
| Main Author: | |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Copernicus Publications
2024-03-01
|
| Series: | Wind Energy Science |
| Online Access: | https://wes.copernicus.org/articles/9/495/2024/wes-9-495-2024.pdf |
| _version_ | 1797279038983634944 |
|---|---|
| author | E. Quon |
| author_facet | E. Quon |
| author_sort | E. Quon |
| collection | DOAJ |
| description | <p>High-fidelity flow modeling with data assimilation enables accurate representation of the wind farm operating environment under realistic, nonstationary atmospheric conditions. Capturing the temporal evolution of the turbulent atmospheric boundary layer is critical to understanding the behavior of wind turbines under operating conditions with simultaneously varying inflow and control inputs. This paper has three parts: the identification of a case study during a field evaluation of wake steering; the development of a tailored mesoscale-to-microscale coupling strategy that resolved local flow conditions within a large-eddy simulation (LES), using observations that did not completely capture the wind and temperature fields throughout the simulation domain; and the application of this coupling strategy to validate high-fidelity aeroelastic predictions of turbine performance and wake interactions with and without wake steering. The case study spans 4.5 h after midnight local time, during which wake steering was toggled on and off five times, achieving yaw offset angles ranging from 0 to 17°. To resolve nonstationary nighttime conditions that exhibited shear instabilities, the turbulence field was evolved starting from the diurnal cycle of the previous day. These background conditions were then used to drive wind farm simulations with two different models: an LES with actuator disk turbines and a steady-state engineering wake model. Subsequent analysis identified two representative periods during which the up- and downstream turbines were most nearly aligned with the mean wind direction and had observed yaw offsets of 0 and 15°. Both periods corresponded to partial waking on the downstream turbine, which had errors in the LES-predicted power of 4 % and 6 %, with and without wake steering. The LES was also able to capture conditions during which an upstream turbine wake induced a speedup at a downstream turbine and increased power production by up to 13 %.</p> |
| first_indexed | 2024-03-07T16:18:34Z |
| format | Article |
| id | doaj.art-3314349434fc4676a7aa4c7d82425629 |
| institution | Directory Open Access Journal |
| issn | 2366-7443 2366-7451 |
| language | English |
| last_indexed | 2024-03-07T16:18:34Z |
| publishDate | 2024-03-01 |
| publisher | Copernicus Publications |
| record_format | Article |
| series | Wind Energy Science |
| spelling | doaj.art-3314349434fc4676a7aa4c7d824256292024-03-04T07:50:09ZengCopernicus PublicationsWind Energy Science2366-74432366-74512024-03-01949551810.5194/wes-9-495-2024Measurement-driven large-eddy simulations of a diurnal cycle during a wake-steering field campaignE. Quon<p>High-fidelity flow modeling with data assimilation enables accurate representation of the wind farm operating environment under realistic, nonstationary atmospheric conditions. Capturing the temporal evolution of the turbulent atmospheric boundary layer is critical to understanding the behavior of wind turbines under operating conditions with simultaneously varying inflow and control inputs. This paper has three parts: the identification of a case study during a field evaluation of wake steering; the development of a tailored mesoscale-to-microscale coupling strategy that resolved local flow conditions within a large-eddy simulation (LES), using observations that did not completely capture the wind and temperature fields throughout the simulation domain; and the application of this coupling strategy to validate high-fidelity aeroelastic predictions of turbine performance and wake interactions with and without wake steering. The case study spans 4.5 h after midnight local time, during which wake steering was toggled on and off five times, achieving yaw offset angles ranging from 0 to 17°. To resolve nonstationary nighttime conditions that exhibited shear instabilities, the turbulence field was evolved starting from the diurnal cycle of the previous day. These background conditions were then used to drive wind farm simulations with two different models: an LES with actuator disk turbines and a steady-state engineering wake model. Subsequent analysis identified two representative periods during which the up- and downstream turbines were most nearly aligned with the mean wind direction and had observed yaw offsets of 0 and 15°. Both periods corresponded to partial waking on the downstream turbine, which had errors in the LES-predicted power of 4 % and 6 %, with and without wake steering. The LES was also able to capture conditions during which an upstream turbine wake induced a speedup at a downstream turbine and increased power production by up to 13 %.</p>https://wes.copernicus.org/articles/9/495/2024/wes-9-495-2024.pdf |
| spellingShingle | E. Quon Measurement-driven large-eddy simulations of a diurnal cycle during a wake-steering field campaign Wind Energy Science |
| title | Measurement-driven large-eddy simulations of a diurnal cycle during a wake-steering field campaign |
| title_full | Measurement-driven large-eddy simulations of a diurnal cycle during a wake-steering field campaign |
| title_fullStr | Measurement-driven large-eddy simulations of a diurnal cycle during a wake-steering field campaign |
| title_full_unstemmed | Measurement-driven large-eddy simulations of a diurnal cycle during a wake-steering field campaign |
| title_short | Measurement-driven large-eddy simulations of a diurnal cycle during a wake-steering field campaign |
| title_sort | measurement driven large eddy simulations of a diurnal cycle during a wake steering field campaign |
| url | https://wes.copernicus.org/articles/9/495/2024/wes-9-495-2024.pdf |
| work_keys_str_mv | AT equon measurementdrivenlargeeddysimulationsofadiurnalcycleduringawakesteeringfieldcampaign |