Identification, classification and expression analysis of the Ras superfamily genes in the Pacific white shrimp, Litopenaeus vannamei
The Ras superfamily of small guanosine triphosphatases (GTPases) are a large group of small GTP-binding proteins, which play crucial roles in basic cellular processes in all eukaryotes. In this study, by analyzing the gene structure, temporal and spatial expression patterns, a total of 108 Ras super...
| Main Authors: | , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Frontiers Media S.A.
2023-01-01
|
| Series: | Frontiers in Marine Science |
| Subjects: | |
| Online Access: | https://www.frontiersin.org/articles/10.3389/fmars.2023.1063857/full |
| _version_ | 1797945387942674432 |
|---|---|
| author | Shuqing Si Shuqing Si Xiaojun Zhang Xiaojun Zhang Xiaojun Zhang Xiaojun Zhang Jianbo Yuan Jianbo Yuan Jianbo Yuan Xiaoxi Zhang Xiaoxi Zhang Xiaoxi Zhang Yang Yu Yang Yu Yang Yu Song Yang Fuhua Li Fuhua Li Fuhua Li |
| author_facet | Shuqing Si Shuqing Si Xiaojun Zhang Xiaojun Zhang Xiaojun Zhang Xiaojun Zhang Jianbo Yuan Jianbo Yuan Jianbo Yuan Xiaoxi Zhang Xiaoxi Zhang Xiaoxi Zhang Yang Yu Yang Yu Yang Yu Song Yang Fuhua Li Fuhua Li Fuhua Li |
| author_sort | Shuqing Si |
| collection | DOAJ |
| description | The Ras superfamily of small guanosine triphosphatases (GTPases) are a large group of small GTP-binding proteins, which play crucial roles in basic cellular processes in all eukaryotes. In this study, by analyzing the gene structure, temporal and spatial expression patterns, a total of 108 Ras superfamily genes were identified in the genome of the Pacific white shrimp Litopenaeus vannamei. We found these genes included not only the classical Ras GTPase superfamily members, but also some unconventional and novel Ras GTPase proteins, which have unknown functions and unique expression patterns. All Ras superfamily genes of L. vannamei were highly conserved within the core G domain and closely related in phylogeny, but they might have two different evolutionary origins. In addition, different Ras GTPase genes exhibited distinct expression patterns in different tissues, development/molting stages and WSSV infection samples of L. vannamei, suggesting that they may have a high functional specialization, and play important roles in regulating the biological processes of cell differentiation, growth and development, immune response, etc. This study provides important clues for the structure, classification, evolution and function of Ras superfamily in shrimp. |
| first_indexed | 2024-04-10T20:54:21Z |
| format | Article |
| id | doaj.art-350b7b572aea47f4980f5dc02755eb22 |
| institution | Directory Open Access Journal |
| issn | 2296-7745 |
| language | English |
| last_indexed | 2024-04-10T20:54:21Z |
| publishDate | 2023-01-01 |
| publisher | Frontiers Media S.A. |
| record_format | Article |
| series | Frontiers in Marine Science |
| spelling | doaj.art-350b7b572aea47f4980f5dc02755eb222023-01-23T06:50:46ZengFrontiers Media S.A.Frontiers in Marine Science2296-77452023-01-011010.3389/fmars.2023.10638571063857Identification, classification and expression analysis of the Ras superfamily genes in the Pacific white shrimp, Litopenaeus vannameiShuqing Si0Shuqing Si1Xiaojun Zhang2Xiaojun Zhang3Xiaojun Zhang4Xiaojun Zhang5Jianbo Yuan6Jianbo Yuan7Jianbo Yuan8Xiaoxi Zhang9Xiaoxi Zhang10Xiaoxi Zhang11Yang Yu12Yang Yu13Yang Yu14Song Yang15Fuhua Li16Fuhua Li17Fuhua Li18School of Life and Sciences, Qingdao Agricultural University, Qingdao, ChinaChinese Academy of Sciences (CAS) and Shandong Province Key Laboratory of Experimental Marine Biology, Institute of Oceanology, Chinese Academy of Sciences, Qingdao, ChinaSchool of Life and Sciences, Qingdao Agricultural University, Qingdao, ChinaChinese Academy of Sciences (CAS) and Shandong Province Key Laboratory of Experimental Marine Biology, Institute of Oceanology, Chinese Academy of Sciences, Qingdao, ChinaLaboratory for Marine Biology and Biotechnology, Qingdao National Laboratory for Marine Science and Technology, Qingdao, ChinaCenter for Ocean Mega-Science, Chinese Academy of Sciences, Qingdao, ChinaChinese Academy of Sciences (CAS) and Shandong Province Key Laboratory of Experimental Marine Biology, Institute of Oceanology, Chinese Academy of Sciences, Qingdao, ChinaLaboratory for Marine Biology and Biotechnology, Qingdao National Laboratory for Marine Science and Technology, Qingdao, ChinaCenter for Ocean Mega-Science, Chinese Academy of Sciences, Qingdao, ChinaChinese Academy of Sciences (CAS) and Shandong Province Key Laboratory of Experimental Marine Biology, Institute of Oceanology, Chinese Academy of Sciences, Qingdao, ChinaLaboratory for Marine Biology and Biotechnology, Qingdao National Laboratory for Marine Science and Technology, Qingdao, ChinaCenter for Ocean Mega-Science, Chinese Academy of Sciences, Qingdao, ChinaChinese Academy of Sciences (CAS) and Shandong Province Key Laboratory of Experimental Marine Biology, Institute of Oceanology, Chinese Academy of Sciences, Qingdao, ChinaLaboratory for Marine Biology and Biotechnology, Qingdao National Laboratory for Marine Science and Technology, Qingdao, ChinaCenter for Ocean Mega-Science, Chinese Academy of Sciences, Qingdao, ChinaSchool of Life and Sciences, Qingdao Agricultural University, Qingdao, ChinaChinese Academy of Sciences (CAS) and Shandong Province Key Laboratory of Experimental Marine Biology, Institute of Oceanology, Chinese Academy of Sciences, Qingdao, ChinaLaboratory for Marine Biology and Biotechnology, Qingdao National Laboratory for Marine Science and Technology, Qingdao, ChinaCenter for Ocean Mega-Science, Chinese Academy of Sciences, Qingdao, ChinaThe Ras superfamily of small guanosine triphosphatases (GTPases) are a large group of small GTP-binding proteins, which play crucial roles in basic cellular processes in all eukaryotes. In this study, by analyzing the gene structure, temporal and spatial expression patterns, a total of 108 Ras superfamily genes were identified in the genome of the Pacific white shrimp Litopenaeus vannamei. We found these genes included not only the classical Ras GTPase superfamily members, but also some unconventional and novel Ras GTPase proteins, which have unknown functions and unique expression patterns. All Ras superfamily genes of L. vannamei were highly conserved within the core G domain and closely related in phylogeny, but they might have two different evolutionary origins. In addition, different Ras GTPase genes exhibited distinct expression patterns in different tissues, development/molting stages and WSSV infection samples of L. vannamei, suggesting that they may have a high functional specialization, and play important roles in regulating the biological processes of cell differentiation, growth and development, immune response, etc. This study provides important clues for the structure, classification, evolution and function of Ras superfamily in shrimp.https://www.frontiersin.org/articles/10.3389/fmars.2023.1063857/fullRas superfamilyGTPase proteinsLitopenaeus vannameigene structure and functiongene expressionimmunity |
| spellingShingle | Shuqing Si Shuqing Si Xiaojun Zhang Xiaojun Zhang Xiaojun Zhang Xiaojun Zhang Jianbo Yuan Jianbo Yuan Jianbo Yuan Xiaoxi Zhang Xiaoxi Zhang Xiaoxi Zhang Yang Yu Yang Yu Yang Yu Song Yang Fuhua Li Fuhua Li Fuhua Li Identification, classification and expression analysis of the Ras superfamily genes in the Pacific white shrimp, Litopenaeus vannamei Frontiers in Marine Science Ras superfamily GTPase proteins Litopenaeus vannamei gene structure and function gene expression immunity |
| title | Identification, classification and expression analysis of the Ras superfamily genes in the Pacific white shrimp, Litopenaeus vannamei |
| title_full | Identification, classification and expression analysis of the Ras superfamily genes in the Pacific white shrimp, Litopenaeus vannamei |
| title_fullStr | Identification, classification and expression analysis of the Ras superfamily genes in the Pacific white shrimp, Litopenaeus vannamei |
| title_full_unstemmed | Identification, classification and expression analysis of the Ras superfamily genes in the Pacific white shrimp, Litopenaeus vannamei |
| title_short | Identification, classification and expression analysis of the Ras superfamily genes in the Pacific white shrimp, Litopenaeus vannamei |
| title_sort | identification classification and expression analysis of the ras superfamily genes in the pacific white shrimp litopenaeus vannamei |
| topic | Ras superfamily GTPase proteins Litopenaeus vannamei gene structure and function gene expression immunity |
| url | https://www.frontiersin.org/articles/10.3389/fmars.2023.1063857/full |
| work_keys_str_mv | AT shuqingsi identificationclassificationandexpressionanalysisoftherassuperfamilygenesinthepacificwhiteshrimplitopenaeusvannamei AT shuqingsi identificationclassificationandexpressionanalysisoftherassuperfamilygenesinthepacificwhiteshrimplitopenaeusvannamei AT xiaojunzhang identificationclassificationandexpressionanalysisoftherassuperfamilygenesinthepacificwhiteshrimplitopenaeusvannamei AT xiaojunzhang identificationclassificationandexpressionanalysisoftherassuperfamilygenesinthepacificwhiteshrimplitopenaeusvannamei AT xiaojunzhang identificationclassificationandexpressionanalysisoftherassuperfamilygenesinthepacificwhiteshrimplitopenaeusvannamei AT xiaojunzhang identificationclassificationandexpressionanalysisoftherassuperfamilygenesinthepacificwhiteshrimplitopenaeusvannamei AT jianboyuan identificationclassificationandexpressionanalysisoftherassuperfamilygenesinthepacificwhiteshrimplitopenaeusvannamei AT jianboyuan identificationclassificationandexpressionanalysisoftherassuperfamilygenesinthepacificwhiteshrimplitopenaeusvannamei AT jianboyuan identificationclassificationandexpressionanalysisoftherassuperfamilygenesinthepacificwhiteshrimplitopenaeusvannamei AT xiaoxizhang identificationclassificationandexpressionanalysisoftherassuperfamilygenesinthepacificwhiteshrimplitopenaeusvannamei AT xiaoxizhang identificationclassificationandexpressionanalysisoftherassuperfamilygenesinthepacificwhiteshrimplitopenaeusvannamei AT xiaoxizhang identificationclassificationandexpressionanalysisoftherassuperfamilygenesinthepacificwhiteshrimplitopenaeusvannamei AT yangyu identificationclassificationandexpressionanalysisoftherassuperfamilygenesinthepacificwhiteshrimplitopenaeusvannamei AT yangyu identificationclassificationandexpressionanalysisoftherassuperfamilygenesinthepacificwhiteshrimplitopenaeusvannamei AT yangyu identificationclassificationandexpressionanalysisoftherassuperfamilygenesinthepacificwhiteshrimplitopenaeusvannamei AT songyang identificationclassificationandexpressionanalysisoftherassuperfamilygenesinthepacificwhiteshrimplitopenaeusvannamei AT fuhuali identificationclassificationandexpressionanalysisoftherassuperfamilygenesinthepacificwhiteshrimplitopenaeusvannamei AT fuhuali identificationclassificationandexpressionanalysisoftherassuperfamilygenesinthepacificwhiteshrimplitopenaeusvannamei AT fuhuali identificationclassificationandexpressionanalysisoftherassuperfamilygenesinthepacificwhiteshrimplitopenaeusvannamei |