GCKR variants increase triglycerides while protecting from insulin resistance in Chinese children.
BACKGROUND: Variants in gene encoding glucokinase regulator protein (GCKR) were found to have converse effects on triglycerides and glucose metabolic traits. We aimed to investigate the influence of GCKR variants for triglycerides and glucose metabolic traits in Chinese children and adults. METHODS...
| Main Authors: | , , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Public Library of Science (PLoS)
2013-01-01
|
| Series: | PLoS ONE |
| Online Access: | http://europepmc.org/articles/PMC3561266?pdf=render |
| _version_ | 1819276867399581696 |
|---|---|
| author | Yue Shen Lijun Wu Bo Xi Xin Liu Xiaoyuan Zhao Hong Cheng Dongqing Hou Xingyu Wang Jie Mi |
| author_facet | Yue Shen Lijun Wu Bo Xi Xin Liu Xiaoyuan Zhao Hong Cheng Dongqing Hou Xingyu Wang Jie Mi |
| author_sort | Yue Shen |
| collection | DOAJ |
| description | BACKGROUND: Variants in gene encoding glucokinase regulator protein (GCKR) were found to have converse effects on triglycerides and glucose metabolic traits. We aimed to investigate the influence of GCKR variants for triglycerides and glucose metabolic traits in Chinese children and adults. METHODS AND RESULTS: We genotyped two GCKR variants rs1260326 and rs1260333 in children and adults, and analyzed the association between two variants and triglycerides, glucose, insulin and HOMA-IR using linear regression model, and estimated the effect on insulin resistance using logistic regression model. Rs1260326 and rs1260333 associated with increased triglycerides in children and adults (p<0.05). In children, both variants significantly reduced insulin (p<0.05. for rs1260326, β = -0.07; for rs1260333, β = -0.07) and HOMA-IR (p<0.05. for rs1260326, β = -0.03; for rs1260333, β = -0.03). There were significant associations between two variants and insulin resistance for children. Under co-dominant model, for CT vs. CC, OR is 0.83 (95%CI 0.69-1.00) for rs1260326, and 0.83 (95%CI 0.68-1.00) for rs1260333; for TT vs. CC, OR is 0.72 (95%CI 0.58-0.88) for rs1260326, and 0.72 (95%CI 0.58-0.89) for rs1260333. Under allele model, for allele T vs. C, the ORs are 0.85 (95%CI 0.76-0.94) and 0.85 (95%CI 0.76-0.94) for rs1260326 and rs1260333, respectively). CONCLUSIONS: Our study confirmed the associations between GCKR variants and triglycerides in Chinese children and adults. Triglycerides-increasing alleles of GCKR variants reduce insulin and HOMA-IR index, and protect from insulin resistance in children. Our results suggested GCKR has an effect on development of insulin resistance in Chinese children. |
| first_indexed | 2024-12-23T23:47:02Z |
| format | Article |
| id | doaj.art-38531f23a4cc4a649f89e433a993071f |
| institution | Directory Open Access Journal |
| issn | 1932-6203 |
| language | English |
| last_indexed | 2024-12-23T23:47:02Z |
| publishDate | 2013-01-01 |
| publisher | Public Library of Science (PLoS) |
| record_format | Article |
| series | PLoS ONE |
| spelling | doaj.art-38531f23a4cc4a649f89e433a993071f2022-12-21T17:25:29ZengPublic Library of Science (PLoS)PLoS ONE1932-62032013-01-0181e5535010.1371/journal.pone.0055350GCKR variants increase triglycerides while protecting from insulin resistance in Chinese children.Yue ShenLijun WuBo XiXin LiuXiaoyuan ZhaoHong ChengDongqing HouXingyu WangJie MiBACKGROUND: Variants in gene encoding glucokinase regulator protein (GCKR) were found to have converse effects on triglycerides and glucose metabolic traits. We aimed to investigate the influence of GCKR variants for triglycerides and glucose metabolic traits in Chinese children and adults. METHODS AND RESULTS: We genotyped two GCKR variants rs1260326 and rs1260333 in children and adults, and analyzed the association between two variants and triglycerides, glucose, insulin and HOMA-IR using linear regression model, and estimated the effect on insulin resistance using logistic regression model. Rs1260326 and rs1260333 associated with increased triglycerides in children and adults (p<0.05). In children, both variants significantly reduced insulin (p<0.05. for rs1260326, β = -0.07; for rs1260333, β = -0.07) and HOMA-IR (p<0.05. for rs1260326, β = -0.03; for rs1260333, β = -0.03). There were significant associations between two variants and insulin resistance for children. Under co-dominant model, for CT vs. CC, OR is 0.83 (95%CI 0.69-1.00) for rs1260326, and 0.83 (95%CI 0.68-1.00) for rs1260333; for TT vs. CC, OR is 0.72 (95%CI 0.58-0.88) for rs1260326, and 0.72 (95%CI 0.58-0.89) for rs1260333. Under allele model, for allele T vs. C, the ORs are 0.85 (95%CI 0.76-0.94) and 0.85 (95%CI 0.76-0.94) for rs1260326 and rs1260333, respectively). CONCLUSIONS: Our study confirmed the associations between GCKR variants and triglycerides in Chinese children and adults. Triglycerides-increasing alleles of GCKR variants reduce insulin and HOMA-IR index, and protect from insulin resistance in children. Our results suggested GCKR has an effect on development of insulin resistance in Chinese children.http://europepmc.org/articles/PMC3561266?pdf=render |
| spellingShingle | Yue Shen Lijun Wu Bo Xi Xin Liu Xiaoyuan Zhao Hong Cheng Dongqing Hou Xingyu Wang Jie Mi GCKR variants increase triglycerides while protecting from insulin resistance in Chinese children. PLoS ONE |
| title | GCKR variants increase triglycerides while protecting from insulin resistance in Chinese children. |
| title_full | GCKR variants increase triglycerides while protecting from insulin resistance in Chinese children. |
| title_fullStr | GCKR variants increase triglycerides while protecting from insulin resistance in Chinese children. |
| title_full_unstemmed | GCKR variants increase triglycerides while protecting from insulin resistance in Chinese children. |
| title_short | GCKR variants increase triglycerides while protecting from insulin resistance in Chinese children. |
| title_sort | gckr variants increase triglycerides while protecting from insulin resistance in chinese children |
| url | http://europepmc.org/articles/PMC3561266?pdf=render |
| work_keys_str_mv | AT yueshen gckrvariantsincreasetriglycerideswhileprotectingfrominsulinresistanceinchinesechildren AT lijunwu gckrvariantsincreasetriglycerideswhileprotectingfrominsulinresistanceinchinesechildren AT boxi gckrvariantsincreasetriglycerideswhileprotectingfrominsulinresistanceinchinesechildren AT xinliu gckrvariantsincreasetriglycerideswhileprotectingfrominsulinresistanceinchinesechildren AT xiaoyuanzhao gckrvariantsincreasetriglycerideswhileprotectingfrominsulinresistanceinchinesechildren AT hongcheng gckrvariantsincreasetriglycerideswhileprotectingfrominsulinresistanceinchinesechildren AT dongqinghou gckrvariantsincreasetriglycerideswhileprotectingfrominsulinresistanceinchinesechildren AT xingyuwang gckrvariantsincreasetriglycerideswhileprotectingfrominsulinresistanceinchinesechildren AT jiemi gckrvariantsincreasetriglycerideswhileprotectingfrominsulinresistanceinchinesechildren |