Characterization and Antagonistic Activity of New Causal Agent of Wilt Disease in Imperata cylindrica (Marasmius palmivorus)
The genus Marasmius is distributed worldwide, along with a precise identification of this fungus as a pathogen on the Imperata cylindrical plant, although its bioactive role is not well understood. The current work was designed to examine the population of Marasmius palmivorus and its antagonistic...
| Main Authors: | , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Journal of Pure and Applied Microbiology
2019-09-01
|
| Series: | Journal of Pure and Applied Microbiology |
| Subjects: | |
| Online Access: | https://microbiologyjournal.org/characterization-and-antagonistic-activity-of-new-causal-agent-of-wilt-disease-in-imperata-cylindrica-marasmius-palmivorus/ |
| _version_ | 1818569708697288704 |
|---|---|
| author | Hassan A. Tamur Haider Jawad Al-Janabi Jawad K. Abood Al-Janabi Liqaa Y. Mohsin Zahraa A.N. Al-Yassiry |
| author_facet | Hassan A. Tamur Haider Jawad Al-Janabi Jawad K. Abood Al-Janabi Liqaa Y. Mohsin Zahraa A.N. Al-Yassiry |
| author_sort | Hassan A. Tamur |
| collection | DOAJ |
| description | The genus Marasmius is distributed worldwide, along with a precise identification of this fungus as
a pathogen on the Imperata cylindrical plant, although its bioactive role is not well understood. The
current work was designed to examine the population of Marasmius palmivorus and its antagonistic
patterns. Sequencing the ITS genetic region of this fungus occurs through verifying the cladistics nature,
and taxonomic validity, in addition to studying the antagonistic potential of this fungus. M. palmivorus
(MG717877.1) was recorded in this plant, which represents a new finding in Iraq mycobiota. Data from
the sequence alignment were used to plot a phylogenetic tree, using the Neighbor-Joining method
(NJ) in molecular evolutionary genetics analysis based on Mega 7. Phylogenetic trees show a close
relationship of 99% between this strain of M. palmivorus (MG717877.1) and international strains. On the
other hand, the maximum antagonistic effect of M. palmivorus has been found to act against Fusarium
solani and F. thapsinum, and to a lesser degree against Penicillium sp., T. harzianum, and P. cyclopium
after 6 to 8 days of incubation. Results confirm the precise nomination of this taxon is M. palmivorus,
which may act as a bioherbicidal and could be used as bioagent against various phytopathogenic fungi. |
| first_indexed | 2024-12-14T06:51:20Z |
| format | Article |
| id | doaj.art-3d53a64677b24545a3be065a3e630fca |
| institution | Directory Open Access Journal |
| issn | 0973-7510 2581-690X |
| language | English |
| last_indexed | 2024-12-14T06:51:20Z |
| publishDate | 2019-09-01 |
| publisher | Journal of Pure and Applied Microbiology |
| record_format | Article |
| series | Journal of Pure and Applied Microbiology |
| spelling | doaj.art-3d53a64677b24545a3be065a3e630fca2022-12-21T23:12:53ZengJournal of Pure and Applied MicrobiologyJournal of Pure and Applied Microbiology0973-75102581-690X2019-09-011331525153610.22207/JPAM.13.3.24Characterization and Antagonistic Activity of New Causal Agent of Wilt Disease in Imperata cylindrica (Marasmius palmivorus)Hassan A. Tamur0Haider Jawad Al-Janabi1Jawad K. Abood Al-Janabi2Liqaa Y. Mohsin3Zahraa A.N. Al-Yassiry4Genetic Engineering Department, Biotechniques College, Green University of Al Qasim, Iraq. Al-Mustaqbal University College, Iraq. Al-Mustaqbal University College, Iraq. Department of Biology, College of Science, University of Babylon, Iraq.Department of Biology, College of Science, University of Babylon, Iraq.The genus Marasmius is distributed worldwide, along with a precise identification of this fungus as a pathogen on the Imperata cylindrical plant, although its bioactive role is not well understood. The current work was designed to examine the population of Marasmius palmivorus and its antagonistic patterns. Sequencing the ITS genetic region of this fungus occurs through verifying the cladistics nature, and taxonomic validity, in addition to studying the antagonistic potential of this fungus. M. palmivorus (MG717877.1) was recorded in this plant, which represents a new finding in Iraq mycobiota. Data from the sequence alignment were used to plot a phylogenetic tree, using the Neighbor-Joining method (NJ) in molecular evolutionary genetics analysis based on Mega 7. Phylogenetic trees show a close relationship of 99% between this strain of M. palmivorus (MG717877.1) and international strains. On the other hand, the maximum antagonistic effect of M. palmivorus has been found to act against Fusarium solani and F. thapsinum, and to a lesser degree against Penicillium sp., T. harzianum, and P. cyclopium after 6 to 8 days of incubation. Results confirm the precise nomination of this taxon is M. palmivorus, which may act as a bioherbicidal and could be used as bioagent against various phytopathogenic fungi.https://microbiologyjournal.org/characterization-and-antagonistic-activity-of-new-causal-agent-of-wilt-disease-in-imperata-cylindrica-marasmius-palmivorus/marasmius palmivorusphylogenetic structureantagonism |
| spellingShingle | Hassan A. Tamur Haider Jawad Al-Janabi Jawad K. Abood Al-Janabi Liqaa Y. Mohsin Zahraa A.N. Al-Yassiry Characterization and Antagonistic Activity of New Causal Agent of Wilt Disease in Imperata cylindrica (Marasmius palmivorus) Journal of Pure and Applied Microbiology marasmius palmivorus phylogenetic structure antagonism |
| title | Characterization and Antagonistic Activity of New Causal Agent of Wilt Disease in Imperata cylindrica (Marasmius palmivorus) |
| title_full | Characterization and Antagonistic Activity of New Causal Agent of Wilt Disease in Imperata cylindrica (Marasmius palmivorus) |
| title_fullStr | Characterization and Antagonistic Activity of New Causal Agent of Wilt Disease in Imperata cylindrica (Marasmius palmivorus) |
| title_full_unstemmed | Characterization and Antagonistic Activity of New Causal Agent of Wilt Disease in Imperata cylindrica (Marasmius palmivorus) |
| title_short | Characterization and Antagonistic Activity of New Causal Agent of Wilt Disease in Imperata cylindrica (Marasmius palmivorus) |
| title_sort | characterization and antagonistic activity of new causal agent of wilt disease in imperata cylindrica marasmius palmivorus |
| topic | marasmius palmivorus phylogenetic structure antagonism |
| url | https://microbiologyjournal.org/characterization-and-antagonistic-activity-of-new-causal-agent-of-wilt-disease-in-imperata-cylindrica-marasmius-palmivorus/ |
| work_keys_str_mv | AT hassanatamur characterizationandantagonisticactivityofnewcausalagentofwiltdiseaseinimperatacylindricamarasmiuspalmivorus AT haiderjawadaljanabi characterizationandantagonisticactivityofnewcausalagentofwiltdiseaseinimperatacylindricamarasmiuspalmivorus AT jawadkaboodaljanabi characterizationandantagonisticactivityofnewcausalagentofwiltdiseaseinimperatacylindricamarasmiuspalmivorus AT liqaaymohsin characterizationandantagonisticactivityofnewcausalagentofwiltdiseaseinimperatacylindricamarasmiuspalmivorus AT zahraaanalyassiry characterizationandantagonisticactivityofnewcausalagentofwiltdiseaseinimperatacylindricamarasmiuspalmivorus |