The Role of NO/sGC/cGMP/PKG Signaling Pathway in Regulation of Platelet Function
Circulating blood platelets are controlled by stimulatory and inhibitory factors, and a tightly regulated equilibrium between these two opposing processes is essential for normal platelet and vascular function. NO/cGMP/ Protein Kinase G (PKG) pathways play a highly significant role in platelet inhib...
| Main Author: | |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
MDPI AG
2022-11-01
|
| Series: | Cells |
| Subjects: | |
| Online Access: | https://www.mdpi.com/2073-4409/11/22/3704 |
| _version_ | 1797465634256191488 |
|---|---|
| author | Stepan Gambaryan |
| author_facet | Stepan Gambaryan |
| author_sort | Stepan Gambaryan |
| collection | DOAJ |
| description | Circulating blood platelets are controlled by stimulatory and inhibitory factors, and a tightly regulated equilibrium between these two opposing processes is essential for normal platelet and vascular function. NO/cGMP/ Protein Kinase G (PKG) pathways play a highly significant role in platelet inhibition, which is supported by a large body of studies and data. This review focused on inconsistent and controversial data of NO/sGC/cGMP/PKG signaling in platelets including sources of NO that activate sGC in platelets, the role of sGC/PKG in platelet inhibition/activation, and the complexity of the regulation of platelet inhibitory mechanisms by cGMP/PKG pathways. In conclusion, we suggest that the recently developed quantitative phosphoproteomic method will be a powerful tool for the analysis of PKG-mediated effects. Analysis of phosphoproteins in PKG-activated platelets will reveal many new PKG substrates. A future detailed analysis of these substrates and their involvement in different platelet inhibitory pathways could be a basis for the development of new antiplatelet drugs that may target only specific aspects of platelet functions. |
| first_indexed | 2024-03-09T18:24:19Z |
| format | Article |
| id | doaj.art-43504f2de4464579853bba54009d990b |
| institution | Directory Open Access Journal |
| issn | 2073-4409 |
| language | English |
| last_indexed | 2024-03-09T18:24:19Z |
| publishDate | 2022-11-01 |
| publisher | MDPI AG |
| record_format | Article |
| series | Cells |
| spelling | doaj.art-43504f2de4464579853bba54009d990b2023-11-24T07:59:39ZengMDPI AGCells2073-44092022-11-011122370410.3390/cells11223704The Role of NO/sGC/cGMP/PKG Signaling Pathway in Regulation of Platelet FunctionStepan Gambaryan0Sechenov Institute of Evolutionary Physiology and Biochemistry of the Russian Academy of Sciences, 194223 St. Petersburg, RussiaCirculating blood platelets are controlled by stimulatory and inhibitory factors, and a tightly regulated equilibrium between these two opposing processes is essential for normal platelet and vascular function. NO/cGMP/ Protein Kinase G (PKG) pathways play a highly significant role in platelet inhibition, which is supported by a large body of studies and data. This review focused on inconsistent and controversial data of NO/sGC/cGMP/PKG signaling in platelets including sources of NO that activate sGC in platelets, the role of sGC/PKG in platelet inhibition/activation, and the complexity of the regulation of platelet inhibitory mechanisms by cGMP/PKG pathways. In conclusion, we suggest that the recently developed quantitative phosphoproteomic method will be a powerful tool for the analysis of PKG-mediated effects. Analysis of phosphoproteins in PKG-activated platelets will reveal many new PKG substrates. A future detailed analysis of these substrates and their involvement in different platelet inhibitory pathways could be a basis for the development of new antiplatelet drugs that may target only specific aspects of platelet functions.https://www.mdpi.com/2073-4409/11/22/3704cGMPnitric oxideplateletNOSPKG |
| spellingShingle | Stepan Gambaryan The Role of NO/sGC/cGMP/PKG Signaling Pathway in Regulation of Platelet Function Cells cGMP nitric oxide platelet NOS PKG |
| title | The Role of NO/sGC/cGMP/PKG Signaling Pathway in Regulation of Platelet Function |
| title_full | The Role of NO/sGC/cGMP/PKG Signaling Pathway in Regulation of Platelet Function |
| title_fullStr | The Role of NO/sGC/cGMP/PKG Signaling Pathway in Regulation of Platelet Function |
| title_full_unstemmed | The Role of NO/sGC/cGMP/PKG Signaling Pathway in Regulation of Platelet Function |
| title_short | The Role of NO/sGC/cGMP/PKG Signaling Pathway in Regulation of Platelet Function |
| title_sort | role of no sgc cgmp pkg signaling pathway in regulation of platelet function |
| topic | cGMP nitric oxide platelet NOS PKG |
| url | https://www.mdpi.com/2073-4409/11/22/3704 |
| work_keys_str_mv | AT stepangambaryan theroleofnosgccgmppkgsignalingpathwayinregulationofplateletfunction AT stepangambaryan roleofnosgccgmppkgsignalingpathwayinregulationofplateletfunction |