Comparative analysis of five type II TA systems identified in Pseudomonas aeruginosa reveals their contributions to persistence and intracellular survival
BackgroundPseudomonas aeruginosa is a grave nosocomial pathogen that persistently inhabits the lungs of patients with cystic fibrosis (CF) and causes various chronic infections. The bacterial toxin–antitoxin (TA) system is associated with latent and long-term infections, but the underlying mechanism...
Main Authors: | , , |
---|---|
Format: | Article |
Language: | English |
Published: |
Frontiers Media S.A.
2023-02-01
|
Series: | Frontiers in Cellular and Infection Microbiology |
Subjects: | |
Online Access: | https://www.frontiersin.org/articles/10.3389/fcimb.2023.1127786/full |
_version_ | 1811168209330503680 |
---|---|
author | Yingjie Song Hong Tang Rui Bao |
author_facet | Yingjie Song Hong Tang Rui Bao |
author_sort | Yingjie Song |
collection | DOAJ |
description | BackgroundPseudomonas aeruginosa is a grave nosocomial pathogen that persistently inhabits the lungs of patients with cystic fibrosis (CF) and causes various chronic infections. The bacterial toxin–antitoxin (TA) system is associated with latent and long-term infections, but the underlying mechanisms remain to be fully characterized.MethodsWe here investigated the diversity and function of five genomic type II TA systems widely distributed among P. aeruginosa clinical isolates. We also examined the distinct structural features of the toxin protein from different TA systems and characterized their contributions to persistence, invasion ability, and intracellular infection caused by P. aeruginosa.ResultsParDE, PA1030/PA1029, and HigBA could modulate persister cell formation under treatment with specific antibiotics. Furthermore, cell-based transcriptional and invasion assays revealed that PA1030/PA1029 and HigBA TA systems were critical for intracellular survival.DiscussionOur results highlight the prevalence and diverse roles of type II TA systems in P. aeruginosa and evaluate the possibility of using PA1030/PA1029 and HigBA TA pairs as targets for novel antibiotic treatments. |
first_indexed | 2024-04-10T16:22:15Z |
format | Article |
id | doaj.art-49a2b9f243ff4344988238c3526d7738 |
institution | Directory Open Access Journal |
issn | 2235-2988 |
language | English |
last_indexed | 2024-04-10T16:22:15Z |
publishDate | 2023-02-01 |
publisher | Frontiers Media S.A. |
record_format | Article |
series | Frontiers in Cellular and Infection Microbiology |
spelling | doaj.art-49a2b9f243ff4344988238c3526d77382023-02-09T11:51:23ZengFrontiers Media S.A.Frontiers in Cellular and Infection Microbiology2235-29882023-02-011310.3389/fcimb.2023.11277861127786Comparative analysis of five type II TA systems identified in Pseudomonas aeruginosa reveals their contributions to persistence and intracellular survivalYingjie Song0Hong Tang1Rui Bao2College of Life Science, Sichuan Normal University, Chengdu, ChinaDivision of Infectious Diseases, State Key Laboratory of Biotherapy and Center of Infectious Diseases, West China Hospital, Sichuan University, Chengdu, ChinaDivision of Infectious Diseases, State Key Laboratory of Biotherapy and Center of Infectious Diseases, West China Hospital, Sichuan University, Chengdu, ChinaBackgroundPseudomonas aeruginosa is a grave nosocomial pathogen that persistently inhabits the lungs of patients with cystic fibrosis (CF) and causes various chronic infections. The bacterial toxin–antitoxin (TA) system is associated with latent and long-term infections, but the underlying mechanisms remain to be fully characterized.MethodsWe here investigated the diversity and function of five genomic type II TA systems widely distributed among P. aeruginosa clinical isolates. We also examined the distinct structural features of the toxin protein from different TA systems and characterized their contributions to persistence, invasion ability, and intracellular infection caused by P. aeruginosa.ResultsParDE, PA1030/PA1029, and HigBA could modulate persister cell formation under treatment with specific antibiotics. Furthermore, cell-based transcriptional and invasion assays revealed that PA1030/PA1029 and HigBA TA systems were critical for intracellular survival.DiscussionOur results highlight the prevalence and diverse roles of type II TA systems in P. aeruginosa and evaluate the possibility of using PA1030/PA1029 and HigBA TA pairs as targets for novel antibiotic treatments.https://www.frontiersin.org/articles/10.3389/fcimb.2023.1127786/fullP. aeruginosa isolatestoxin-antitoxin systempersistenceinvasion abilityintracellular survival |
spellingShingle | Yingjie Song Hong Tang Rui Bao Comparative analysis of five type II TA systems identified in Pseudomonas aeruginosa reveals their contributions to persistence and intracellular survival Frontiers in Cellular and Infection Microbiology P. aeruginosa isolates toxin-antitoxin system persistence invasion ability intracellular survival |
title | Comparative analysis of five type II TA systems identified in Pseudomonas aeruginosa reveals their contributions to persistence and intracellular survival |
title_full | Comparative analysis of five type II TA systems identified in Pseudomonas aeruginosa reveals their contributions to persistence and intracellular survival |
title_fullStr | Comparative analysis of five type II TA systems identified in Pseudomonas aeruginosa reveals their contributions to persistence and intracellular survival |
title_full_unstemmed | Comparative analysis of five type II TA systems identified in Pseudomonas aeruginosa reveals their contributions to persistence and intracellular survival |
title_short | Comparative analysis of five type II TA systems identified in Pseudomonas aeruginosa reveals their contributions to persistence and intracellular survival |
title_sort | comparative analysis of five type ii ta systems identified in pseudomonas aeruginosa reveals their contributions to persistence and intracellular survival |
topic | P. aeruginosa isolates toxin-antitoxin system persistence invasion ability intracellular survival |
url | https://www.frontiersin.org/articles/10.3389/fcimb.2023.1127786/full |
work_keys_str_mv | AT yingjiesong comparativeanalysisoffivetypeiitasystemsidentifiedinpseudomonasaeruginosarevealstheircontributionstopersistenceandintracellularsurvival AT hongtang comparativeanalysisoffivetypeiitasystemsidentifiedinpseudomonasaeruginosarevealstheircontributionstopersistenceandintracellularsurvival AT ruibao comparativeanalysisoffivetypeiitasystemsidentifiedinpseudomonasaeruginosarevealstheircontributionstopersistenceandintracellularsurvival |