Preparation and Application of a Chemical Probe for Identifying the Targets of the Marine Cyclic Peptide Kapakahine A

Marine organisms are a rich source of bioactive secondary metabolites. Although many marine natural products with bioactivities have been isolated, successful elucidation of their mechanisms of action remains limited. In this study, we prepared a probe molecule based on the marine cyclic peptide kap...

Full description

Bibliographic Details
Main Authors: Rie Kamihira, Yoichi Nakao
Format: Article
Language:English
Published: MDPI AG 2022-02-01
Series:Molecules
Subjects:
Online Access:https://www.mdpi.com/1420-3049/27/3/1072
_version_ 1827659644024127488
author Rie Kamihira
Yoichi Nakao
author_facet Rie Kamihira
Yoichi Nakao
author_sort Rie Kamihira
collection DOAJ
description Marine organisms are a rich source of bioactive secondary metabolites. Although many marine natural products with bioactivities have been isolated, successful elucidation of their mechanisms of action remains limited. In this study, we prepared a probe molecule based on the marine cyclic peptide kapakahine A (<b>1</b>) by introducing a linker with an azide terminal group, which enables the introduction of fluorescent groups for the effective monitoring of subcellular localization, or coupling to affinity beads for the pull-down of target proteins. The results of LC/MS/MS measurements, ProteinPilot analysis, and Western blotting suggest that kapakahine A interacts with the mitochondrial inner membrane proteins PHB1, PHB2, and ANT2, which is consistent with the results of the subcellular localization analysis using a fluorescent probe.
first_indexed 2024-03-09T23:26:15Z
format Article
id doaj.art-4c1e6d9d9b3b4461ad7b8a9879cc4f80
institution Directory Open Access Journal
issn 1420-3049
language English
last_indexed 2024-03-09T23:26:15Z
publishDate 2022-02-01
publisher MDPI AG
record_format Article
series Molecules
spelling doaj.art-4c1e6d9d9b3b4461ad7b8a9879cc4f802023-11-23T17:17:08ZengMDPI AGMolecules1420-30492022-02-01273107210.3390/molecules27031072Preparation and Application of a Chemical Probe for Identifying the Targets of the Marine Cyclic Peptide Kapakahine ARie Kamihira0Yoichi Nakao1Research Institute for Science and Engineering, Waseda University, 3-4-1 Okubo, Shinjuku-ku, Tokyo 169-8555, JapanResearch Institute for Science and Engineering, Waseda University, 3-4-1 Okubo, Shinjuku-ku, Tokyo 169-8555, JapanMarine organisms are a rich source of bioactive secondary metabolites. Although many marine natural products with bioactivities have been isolated, successful elucidation of their mechanisms of action remains limited. In this study, we prepared a probe molecule based on the marine cyclic peptide kapakahine A (<b>1</b>) by introducing a linker with an azide terminal group, which enables the introduction of fluorescent groups for the effective monitoring of subcellular localization, or coupling to affinity beads for the pull-down of target proteins. The results of LC/MS/MS measurements, ProteinPilot analysis, and Western blotting suggest that kapakahine A interacts with the mitochondrial inner membrane proteins PHB1, PHB2, and ANT2, which is consistent with the results of the subcellular localization analysis using a fluorescent probe.https://www.mdpi.com/1420-3049/27/3/1072marine natural productcyclic peptidechemical fluorescent probetarget proteinchemical biology
spellingShingle Rie Kamihira
Yoichi Nakao
Preparation and Application of a Chemical Probe for Identifying the Targets of the Marine Cyclic Peptide Kapakahine A
Molecules
marine natural product
cyclic peptide
chemical fluorescent probe
target protein
chemical biology
title Preparation and Application of a Chemical Probe for Identifying the Targets of the Marine Cyclic Peptide Kapakahine A
title_full Preparation and Application of a Chemical Probe for Identifying the Targets of the Marine Cyclic Peptide Kapakahine A
title_fullStr Preparation and Application of a Chemical Probe for Identifying the Targets of the Marine Cyclic Peptide Kapakahine A
title_full_unstemmed Preparation and Application of a Chemical Probe for Identifying the Targets of the Marine Cyclic Peptide Kapakahine A
title_short Preparation and Application of a Chemical Probe for Identifying the Targets of the Marine Cyclic Peptide Kapakahine A
title_sort preparation and application of a chemical probe for identifying the targets of the marine cyclic peptide kapakahine a
topic marine natural product
cyclic peptide
chemical fluorescent probe
target protein
chemical biology
url https://www.mdpi.com/1420-3049/27/3/1072
work_keys_str_mv AT riekamihira preparationandapplicationofachemicalprobeforidentifyingthetargetsofthemarinecyclicpeptidekapakahinea
AT yoichinakao preparationandapplicationofachemicalprobeforidentifyingthetargetsofthemarinecyclicpeptidekapakahinea