Preparation and Application of a Chemical Probe for Identifying the Targets of the Marine Cyclic Peptide Kapakahine A
Marine organisms are a rich source of bioactive secondary metabolites. Although many marine natural products with bioactivities have been isolated, successful elucidation of their mechanisms of action remains limited. In this study, we prepared a probe molecule based on the marine cyclic peptide kap...
| Main Authors: | , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
MDPI AG
2022-02-01
|
| Series: | Molecules |
| Subjects: | |
| Online Access: | https://www.mdpi.com/1420-3049/27/3/1072 |
| _version_ | 1827659644024127488 |
|---|---|
| author | Rie Kamihira Yoichi Nakao |
| author_facet | Rie Kamihira Yoichi Nakao |
| author_sort | Rie Kamihira |
| collection | DOAJ |
| description | Marine organisms are a rich source of bioactive secondary metabolites. Although many marine natural products with bioactivities have been isolated, successful elucidation of their mechanisms of action remains limited. In this study, we prepared a probe molecule based on the marine cyclic peptide kapakahine A (<b>1</b>) by introducing a linker with an azide terminal group, which enables the introduction of fluorescent groups for the effective monitoring of subcellular localization, or coupling to affinity beads for the pull-down of target proteins. The results of LC/MS/MS measurements, ProteinPilot analysis, and Western blotting suggest that kapakahine A interacts with the mitochondrial inner membrane proteins PHB1, PHB2, and ANT2, which is consistent with the results of the subcellular localization analysis using a fluorescent probe. |
| first_indexed | 2024-03-09T23:26:15Z |
| format | Article |
| id | doaj.art-4c1e6d9d9b3b4461ad7b8a9879cc4f80 |
| institution | Directory Open Access Journal |
| issn | 1420-3049 |
| language | English |
| last_indexed | 2024-03-09T23:26:15Z |
| publishDate | 2022-02-01 |
| publisher | MDPI AG |
| record_format | Article |
| series | Molecules |
| spelling | doaj.art-4c1e6d9d9b3b4461ad7b8a9879cc4f802023-11-23T17:17:08ZengMDPI AGMolecules1420-30492022-02-01273107210.3390/molecules27031072Preparation and Application of a Chemical Probe for Identifying the Targets of the Marine Cyclic Peptide Kapakahine ARie Kamihira0Yoichi Nakao1Research Institute for Science and Engineering, Waseda University, 3-4-1 Okubo, Shinjuku-ku, Tokyo 169-8555, JapanResearch Institute for Science and Engineering, Waseda University, 3-4-1 Okubo, Shinjuku-ku, Tokyo 169-8555, JapanMarine organisms are a rich source of bioactive secondary metabolites. Although many marine natural products with bioactivities have been isolated, successful elucidation of their mechanisms of action remains limited. In this study, we prepared a probe molecule based on the marine cyclic peptide kapakahine A (<b>1</b>) by introducing a linker with an azide terminal group, which enables the introduction of fluorescent groups for the effective monitoring of subcellular localization, or coupling to affinity beads for the pull-down of target proteins. The results of LC/MS/MS measurements, ProteinPilot analysis, and Western blotting suggest that kapakahine A interacts with the mitochondrial inner membrane proteins PHB1, PHB2, and ANT2, which is consistent with the results of the subcellular localization analysis using a fluorescent probe.https://www.mdpi.com/1420-3049/27/3/1072marine natural productcyclic peptidechemical fluorescent probetarget proteinchemical biology |
| spellingShingle | Rie Kamihira Yoichi Nakao Preparation and Application of a Chemical Probe for Identifying the Targets of the Marine Cyclic Peptide Kapakahine A Molecules marine natural product cyclic peptide chemical fluorescent probe target protein chemical biology |
| title | Preparation and Application of a Chemical Probe for Identifying the Targets of the Marine Cyclic Peptide Kapakahine A |
| title_full | Preparation and Application of a Chemical Probe for Identifying the Targets of the Marine Cyclic Peptide Kapakahine A |
| title_fullStr | Preparation and Application of a Chemical Probe for Identifying the Targets of the Marine Cyclic Peptide Kapakahine A |
| title_full_unstemmed | Preparation and Application of a Chemical Probe for Identifying the Targets of the Marine Cyclic Peptide Kapakahine A |
| title_short | Preparation and Application of a Chemical Probe for Identifying the Targets of the Marine Cyclic Peptide Kapakahine A |
| title_sort | preparation and application of a chemical probe for identifying the targets of the marine cyclic peptide kapakahine a |
| topic | marine natural product cyclic peptide chemical fluorescent probe target protein chemical biology |
| url | https://www.mdpi.com/1420-3049/27/3/1072 |
| work_keys_str_mv | AT riekamihira preparationandapplicationofachemicalprobeforidentifyingthetargetsofthemarinecyclicpeptidekapakahinea AT yoichinakao preparationandapplicationofachemicalprobeforidentifyingthetargetsofthemarinecyclicpeptidekapakahinea |