Association between Dietary Intake and Faecal Microbiota in Children with Cystic Fibrosis
A “high-fat, high-energy diet” is commonly recommended for children with cystic fibrosis (CF), leading to negative consequences on dietary patterns that could contribute to altered colonic microbiota. The aim of this study was to assess dietary intake and to identify possible associations with the c...
| Main Authors: | , , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
MDPI AG
2023-12-01
|
| Series: | Nutrients |
| Subjects: | |
| Online Access: | https://www.mdpi.com/2072-6643/15/24/5013 |
| _version_ | 1797379774979506176 |
|---|---|
| author | Jazmín Viteri-Echeverría Joaquim Calvo-Lerma Miguel Ferriz-Jordán María Garriga Jorge García-Hernández Ana Heredia Carmen Ribes-Koninckx Ana Andrés Andrea Asensio-Grau |
| author_facet | Jazmín Viteri-Echeverría Joaquim Calvo-Lerma Miguel Ferriz-Jordán María Garriga Jorge García-Hernández Ana Heredia Carmen Ribes-Koninckx Ana Andrés Andrea Asensio-Grau |
| author_sort | Jazmín Viteri-Echeverría |
| collection | DOAJ |
| description | A “high-fat, high-energy diet” is commonly recommended for children with cystic fibrosis (CF), leading to negative consequences on dietary patterns that could contribute to altered colonic microbiota. The aim of this study was to assess dietary intake and to identify possible associations with the composition of faecal microbiota in a cohort of children with CF. A cross-sectional observational study was conducted, including a 3-day food record simultaneously with the collection of faecal samples. The results showed a high fat intake (43.9% of total energy intake) and a mean dietary fibre intake of 10.6 g/day. The faecal microbiota was characterised at the phylum level as 54.5% Firmicutes and revealed an altered proportion between Proteobacteria (32%) and Bacteroidota (2.2%). Significant associations were found, including a negative association between protein, meat, and fish intake and Bifidobacterium, a positive association between lipids and <i>Escherichia/Shigella</i> and Streptococcus, a negative association between carbohydrates and <i>Veillonella</i> and <i>Klebsiella</i>, and a positive association between total dietary fibre and <i>Bacteroides</i> and <i>Roseburia</i>. The results reveal that a “high-fat, high-energy” diet does not satisfy dietary fibre intake from healthy food sources in children with CF. Further interventional studies are encouraged to explore the potential of shifting to a high-fibre or standard healthy diet to improve colonic microbiota. |
| first_indexed | 2024-03-08T20:27:54Z |
| format | Article |
| id | doaj.art-4e72d632466444fd9ee2fbdf04bcc37b |
| institution | Directory Open Access Journal |
| issn | 2072-6643 |
| language | English |
| last_indexed | 2024-03-08T20:27:54Z |
| publishDate | 2023-12-01 |
| publisher | MDPI AG |
| record_format | Article |
| series | Nutrients |
| spelling | doaj.art-4e72d632466444fd9ee2fbdf04bcc37b2023-12-22T14:29:50ZengMDPI AGNutrients2072-66432023-12-011524501310.3390/nu15245013Association between Dietary Intake and Faecal Microbiota in Children with Cystic FibrosisJazmín Viteri-Echeverría0Joaquim Calvo-Lerma1Miguel Ferriz-Jordán2María Garriga3Jorge García-Hernández4Ana Heredia5Carmen Ribes-Koninckx6Ana Andrés7Andrea Asensio-Grau8University Institute of Food Engineering (FoodUPV), Polytechnic University of Valencia, Camino de Vera s/n, 46022 València, SpainUniversity Institute of Food Engineering (FoodUPV), Polytechnic University of Valencia, Camino de Vera s/n, 46022 València, SpainUniversity Institute of Food Engineering (FoodUPV), Polytechnic University of Valencia, Camino de Vera s/n, 46022 València, SpainCystic Fibrosis Unit, University Hospital Ramón y Cajal, M-607, 9, 100, 28034 Madrid, SpainAdvanced Food Microbiology Centre (CAMA), University of Valencia, Camino de Vera s/n, 46022 València, SpainUniversity Institute of Food Engineering (FoodUPV), Polytechnic University of Valencia, Camino de Vera s/n, 46022 València, SpainHealth Research Institute La Fe, Celiac Disease and Digestive Immunopathology Unit, Hospital Universitari i Politècnic La Fe, 46026 Valencia, SpainUniversity Institute of Food Engineering (FoodUPV), Polytechnic University of Valencia, Camino de Vera s/n, 46022 València, SpainUniversity Institute of Food Engineering (FoodUPV), Polytechnic University of Valencia, Camino de Vera s/n, 46022 València, SpainA “high-fat, high-energy diet” is commonly recommended for children with cystic fibrosis (CF), leading to negative consequences on dietary patterns that could contribute to altered colonic microbiota. The aim of this study was to assess dietary intake and to identify possible associations with the composition of faecal microbiota in a cohort of children with CF. A cross-sectional observational study was conducted, including a 3-day food record simultaneously with the collection of faecal samples. The results showed a high fat intake (43.9% of total energy intake) and a mean dietary fibre intake of 10.6 g/day. The faecal microbiota was characterised at the phylum level as 54.5% Firmicutes and revealed an altered proportion between Proteobacteria (32%) and Bacteroidota (2.2%). Significant associations were found, including a negative association between protein, meat, and fish intake and Bifidobacterium, a positive association between lipids and <i>Escherichia/Shigella</i> and Streptococcus, a negative association between carbohydrates and <i>Veillonella</i> and <i>Klebsiella</i>, and a positive association between total dietary fibre and <i>Bacteroides</i> and <i>Roseburia</i>. The results reveal that a “high-fat, high-energy” diet does not satisfy dietary fibre intake from healthy food sources in children with CF. Further interventional studies are encouraged to explore the potential of shifting to a high-fibre or standard healthy diet to improve colonic microbiota.https://www.mdpi.com/2072-6643/15/24/5013dietcystic fibrosismicrobiotadietary fibrefat |
| spellingShingle | Jazmín Viteri-Echeverría Joaquim Calvo-Lerma Miguel Ferriz-Jordán María Garriga Jorge García-Hernández Ana Heredia Carmen Ribes-Koninckx Ana Andrés Andrea Asensio-Grau Association between Dietary Intake and Faecal Microbiota in Children with Cystic Fibrosis Nutrients diet cystic fibrosis microbiota dietary fibre fat |
| title | Association between Dietary Intake and Faecal Microbiota in Children with Cystic Fibrosis |
| title_full | Association between Dietary Intake and Faecal Microbiota in Children with Cystic Fibrosis |
| title_fullStr | Association between Dietary Intake and Faecal Microbiota in Children with Cystic Fibrosis |
| title_full_unstemmed | Association between Dietary Intake and Faecal Microbiota in Children with Cystic Fibrosis |
| title_short | Association between Dietary Intake and Faecal Microbiota in Children with Cystic Fibrosis |
| title_sort | association between dietary intake and faecal microbiota in children with cystic fibrosis |
| topic | diet cystic fibrosis microbiota dietary fibre fat |
| url | https://www.mdpi.com/2072-6643/15/24/5013 |
| work_keys_str_mv | AT jazminviteriecheverria associationbetweendietaryintakeandfaecalmicrobiotainchildrenwithcysticfibrosis AT joaquimcalvolerma associationbetweendietaryintakeandfaecalmicrobiotainchildrenwithcysticfibrosis AT miguelferrizjordan associationbetweendietaryintakeandfaecalmicrobiotainchildrenwithcysticfibrosis AT mariagarriga associationbetweendietaryintakeandfaecalmicrobiotainchildrenwithcysticfibrosis AT jorgegarciahernandez associationbetweendietaryintakeandfaecalmicrobiotainchildrenwithcysticfibrosis AT anaheredia associationbetweendietaryintakeandfaecalmicrobiotainchildrenwithcysticfibrosis AT carmenribeskoninckx associationbetweendietaryintakeandfaecalmicrobiotainchildrenwithcysticfibrosis AT anaandres associationbetweendietaryintakeandfaecalmicrobiotainchildrenwithcysticfibrosis AT andreaasensiograu associationbetweendietaryintakeandfaecalmicrobiotainchildrenwithcysticfibrosis |