Corrigendum: The FMRFamide-like peptide family in nematodes
| Main Authors: | , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Frontiers Media S.A.
2015-04-01
|
| Series: | Frontiers in Neuroscience |
| Subjects: | |
| Online Access: | http://journal.frontiersin.org/Journal/10.3389/fnins.2015.00120/full |
| _version_ | 1818684746686791680 |
|---|---|
| author | Katleen ePeymen Jan eWatteyne Lotte eFrooninckx Liliane eSchoofs Isabel eBeets |
| author_facet | Katleen ePeymen Jan eWatteyne Lotte eFrooninckx Liliane eSchoofs Isabel eBeets |
| author_sort | Katleen ePeymen |
| collection | DOAJ |
| first_indexed | 2024-12-17T10:55:32Z |
| format | Article |
| id | doaj.art-53abbe1473c345049dfbf5be9a6a085c |
| institution | Directory Open Access Journal |
| issn | 1662-453X |
| language | English |
| last_indexed | 2024-12-17T10:55:32Z |
| publishDate | 2015-04-01 |
| publisher | Frontiers Media S.A. |
| record_format | Article |
| series | Frontiers in Neuroscience |
| spelling | doaj.art-53abbe1473c345049dfbf5be9a6a085c2022-12-21T21:51:50ZengFrontiers Media S.A.Frontiers in Neuroscience1662-453X2015-04-01910.3389/fnins.2015.00120141183Corrigendum: The FMRFamide-like peptide family in nematodesKatleen ePeymen0Jan eWatteyne1Lotte eFrooninckx2Liliane eSchoofs3Isabel eBeets4KU LeuvenKU LeuvenKU LeuvenKU LeuvenKU Leuvenhttp://journal.frontiersin.org/Journal/10.3389/fnins.2015.00120/fullFeeding BehaviorReproductionC. elegansNematodesNeuropeptideG protein-coupled receptor |
| spellingShingle | Katleen ePeymen Jan eWatteyne Lotte eFrooninckx Liliane eSchoofs Isabel eBeets Corrigendum: The FMRFamide-like peptide family in nematodes Frontiers in Neuroscience Feeding Behavior Reproduction C. elegans Nematodes Neuropeptide G protein-coupled receptor |
| title | Corrigendum: The FMRFamide-like peptide family in nematodes |
| title_full | Corrigendum: The FMRFamide-like peptide family in nematodes |
| title_fullStr | Corrigendum: The FMRFamide-like peptide family in nematodes |
| title_full_unstemmed | Corrigendum: The FMRFamide-like peptide family in nematodes |
| title_short | Corrigendum: The FMRFamide-like peptide family in nematodes |
| title_sort | corrigendum the fmrfamide like peptide family in nematodes |
| topic | Feeding Behavior Reproduction C. elegans Nematodes Neuropeptide G protein-coupled receptor |
| url | http://journal.frontiersin.org/Journal/10.3389/fnins.2015.00120/full |
| work_keys_str_mv | AT katleenepeymen corrigendumthefmrfamidelikepeptidefamilyinnematodes AT janewatteyne corrigendumthefmrfamidelikepeptidefamilyinnematodes AT lotteefrooninckx corrigendumthefmrfamidelikepeptidefamilyinnematodes AT lilianeeschoofs corrigendumthefmrfamidelikepeptidefamilyinnematodes AT isabelebeets corrigendumthefmrfamidelikepeptidefamilyinnematodes |