Orlicz difference sequence spaces generated by infinite matrices and de la Vallée-Poussin mean of order α
In this paper we introduce the spaces V^λ[A,M,Δ,p]o,V^λ[A,M,Δ,p] and V^λ[A,M,Δ,p]∞ generated by infinite matrices defined by Orlicz functions. Also we introduce the concept of S^λ[A,Δ]−convergence and derive some results between the spaces S^λ[A,Δ] and V^λ[A,Δ]. Further, we study some geometrical pr...
| Main Authors: | , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
SpringerOpen
2016-10-01
|
| Series: | Journal of the Egyptian Mathematical Society |
| Subjects: | |
| Online Access: | http://www.sciencedirect.com/science/article/pii/S1110256X16300013 |
| _version_ | 1818542192743940096 |
|---|---|
| author | Bipan Hazarika Ayhan Esi Ayten Esi Karan Tamang |
| author_facet | Bipan Hazarika Ayhan Esi Ayten Esi Karan Tamang |
| author_sort | Bipan Hazarika |
| collection | DOAJ |
| description | In this paper we introduce the spaces V^λ[A,M,Δ,p]o,V^λ[A,M,Δ,p] and V^λ[A,M,Δ,p]∞ generated by infinite matrices defined by Orlicz functions. Also we introduce the concept of S^λ[A,Δ]−convergence and derive some results between the spaces S^λ[A,Δ] and V^λ[A,Δ]. Further, we study some geometrical properties such as order continuity, the Fatou property and the Banach–Saks property of the new space V^λα[A,Δ,p]∞. Finally, we introduce the notion of almost λ-statistically-[A, Δ]-convergence of order α or S^λα[A,Δ]−convergence and obtain some inclusion relations between the set S^λα[A,Δ] and the space V^λα[A,Δ,p]∞. |
| first_indexed | 2024-12-11T22:18:53Z |
| format | Article |
| id | doaj.art-565ffd3c451d4c1aaa667d07c06412f8 |
| institution | Directory Open Access Journal |
| issn | 1110-256X |
| language | English |
| last_indexed | 2024-12-11T22:18:53Z |
| publishDate | 2016-10-01 |
| publisher | SpringerOpen |
| record_format | Article |
| series | Journal of the Egyptian Mathematical Society |
| spelling | doaj.art-565ffd3c451d4c1aaa667d07c06412f82022-12-22T00:48:31ZengSpringerOpenJournal of the Egyptian Mathematical Society1110-256X2016-10-0124454555410.1016/j.joems.2015.12.004Orlicz difference sequence spaces generated by infinite matrices and de la Vallée-Poussin mean of order αBipan Hazarika0Ayhan Esi1Ayten Esi2Karan Tamang3Department of Mathematics, Rajiv Gandhi University, Rono Hills, Doimukh 791112, Arunachal Pradesh, IndiaAdıyaman University, Department of Mathematics, Adıyaman, 02040, TurkeyAdıyaman University, Department of Mathematics, Adıyaman, 02040, TurkeyDepartment of Mathematics, North Eastern Regional Institute of Science and Technology, Nirjuli 791109, Arunachal Pradesh, IndiaIn this paper we introduce the spaces V^λ[A,M,Δ,p]o,V^λ[A,M,Δ,p] and V^λ[A,M,Δ,p]∞ generated by infinite matrices defined by Orlicz functions. Also we introduce the concept of S^λ[A,Δ]−convergence and derive some results between the spaces S^λ[A,Δ] and V^λ[A,Δ]. Further, we study some geometrical properties such as order continuity, the Fatou property and the Banach–Saks property of the new space V^λα[A,Δ,p]∞. Finally, we introduce the notion of almost λ-statistically-[A, Δ]-convergence of order α or S^λα[A,Δ]−convergence and obtain some inclusion relations between the set S^λα[A,Δ] and the space V^λα[A,Δ,p]∞.http://www.sciencedirect.com/science/article/pii/S1110256X16300013Infinite matrixOrlicz functionStatistical convergenceλ-sequence |
| spellingShingle | Bipan Hazarika Ayhan Esi Ayten Esi Karan Tamang Orlicz difference sequence spaces generated by infinite matrices and de la Vallée-Poussin mean of order α Journal of the Egyptian Mathematical Society Infinite matrix Orlicz function Statistical convergence λ-sequence |
| title | Orlicz difference sequence spaces generated by infinite matrices and de la Vallée-Poussin mean of order α |
| title_full | Orlicz difference sequence spaces generated by infinite matrices and de la Vallée-Poussin mean of order α |
| title_fullStr | Orlicz difference sequence spaces generated by infinite matrices and de la Vallée-Poussin mean of order α |
| title_full_unstemmed | Orlicz difference sequence spaces generated by infinite matrices and de la Vallée-Poussin mean of order α |
| title_short | Orlicz difference sequence spaces generated by infinite matrices and de la Vallée-Poussin mean of order α |
| title_sort | orlicz difference sequence spaces generated by infinite matrices and de la vallee poussin mean of order α |
| topic | Infinite matrix Orlicz function Statistical convergence λ-sequence |
| url | http://www.sciencedirect.com/science/article/pii/S1110256X16300013 |
| work_keys_str_mv | AT bipanhazarika orliczdifferencesequencespacesgeneratedbyinfinitematricesanddelavalleepoussinmeanofordera AT ayhanesi orliczdifferencesequencespacesgeneratedbyinfinitematricesanddelavalleepoussinmeanofordera AT aytenesi orliczdifferencesequencespacesgeneratedbyinfinitematricesanddelavalleepoussinmeanofordera AT karantamang orliczdifferencesequencespacesgeneratedbyinfinitematricesanddelavalleepoussinmeanofordera |