Coordinated recruitment of conserved defense-signaling pathways in PVYO-Infected Nicotiana benthamiana
Potato virus Y (PVY) is an aphid-transmitted potyvirus that affects economically important solanaceous species. In this study, the phenomena and mechanisms following infection with PVY were investigated in tobacco (Nicotiana benthamiana). In tobacco plants, infection with a mild strain of PVY (PVYO)...
| Main Authors: | , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Taylor & Francis Group
2023-12-01
|
| Series: | Plant Signaling & Behavior |
| Subjects: | |
| Online Access: | http://dx.doi.org/10.1080/15592324.2023.2252972 |
| _version_ | 1797351888935452672 |
|---|---|
| author | Won-Jin Kim Woong Kim Youngsoon Kim Hyeonsook Cheong Seok-Jun Kim |
| author_facet | Won-Jin Kim Woong Kim Youngsoon Kim Hyeonsook Cheong Seok-Jun Kim |
| author_sort | Won-Jin Kim |
| collection | DOAJ |
| description | Potato virus Y (PVY) is an aphid-transmitted potyvirus that affects economically important solanaceous species. In this study, the phenomena and mechanisms following infection with PVY were investigated in tobacco (Nicotiana benthamiana). In tobacco plants, infection with a mild strain of PVY (PVYO) induced stunted growth in the first two leaves at the shoot apex starting 7 days post-infection (dpi), and mosaic symptoms began to appear on newly developing young leaves at 14 dpi. Using enzyme-linked immunosorbent assay and ultrastructure analysis, we confirmed that viral particles accumulated only in the upper developing leaves of infected plants. We analyzed reactive oxygen species (ROS) generation in leaves from the bottom to the top of the plants to investigate whether delayed symptom development in leaves was associated with a defense response to the virus. In addition, the ultrastructural analysis confirmed the increase of ATG4 and ATG8, which are autophagy markers by endoplasmic reticulum (ER) stress, and the expression of genes involved in viral RNA suppression. Overall, our results suggested that viral RNA silencing and induced autophagy may play a role in the inhibition of viral symptom development in host plants in response to PVYO infection. |
| first_indexed | 2024-03-08T13:08:15Z |
| format | Article |
| id | doaj.art-591274f6b2704e6fbb593525cd7939ab |
| institution | Directory Open Access Journal |
| issn | 1559-2316 1559-2324 |
| language | English |
| last_indexed | 2024-03-08T13:08:15Z |
| publishDate | 2023-12-01 |
| publisher | Taylor & Francis Group |
| record_format | Article |
| series | Plant Signaling & Behavior |
| spelling | doaj.art-591274f6b2704e6fbb593525cd7939ab2024-01-18T15:58:23ZengTaylor & Francis GroupPlant Signaling & Behavior1559-23161559-23242023-12-0118110.1080/15592324.2023.22529722252972Coordinated recruitment of conserved defense-signaling pathways in PVYO-Infected Nicotiana benthamianaWon-Jin Kim0Woong Kim1Youngsoon Kim2Hyeonsook Cheong3Seok-Jun Kim4Chosun UniversityChosun UniversityCo., LtdChosun UniversityChosun UniversityPotato virus Y (PVY) is an aphid-transmitted potyvirus that affects economically important solanaceous species. In this study, the phenomena and mechanisms following infection with PVY were investigated in tobacco (Nicotiana benthamiana). In tobacco plants, infection with a mild strain of PVY (PVYO) induced stunted growth in the first two leaves at the shoot apex starting 7 days post-infection (dpi), and mosaic symptoms began to appear on newly developing young leaves at 14 dpi. Using enzyme-linked immunosorbent assay and ultrastructure analysis, we confirmed that viral particles accumulated only in the upper developing leaves of infected plants. We analyzed reactive oxygen species (ROS) generation in leaves from the bottom to the top of the plants to investigate whether delayed symptom development in leaves was associated with a defense response to the virus. In addition, the ultrastructural analysis confirmed the increase of ATG4 and ATG8, which are autophagy markers by endoplasmic reticulum (ER) stress, and the expression of genes involved in viral RNA suppression. Overall, our results suggested that viral RNA silencing and induced autophagy may play a role in the inhibition of viral symptom development in host plants in response to PVYO infection.http://dx.doi.org/10.1080/15592324.2023.2252972antioxidantdefensepotyvirusrosatg4atg8 |
| spellingShingle | Won-Jin Kim Woong Kim Youngsoon Kim Hyeonsook Cheong Seok-Jun Kim Coordinated recruitment of conserved defense-signaling pathways in PVYO-Infected Nicotiana benthamiana Plant Signaling & Behavior antioxidant defense potyvirus ros atg4 atg8 |
| title | Coordinated recruitment of conserved defense-signaling pathways in PVYO-Infected Nicotiana benthamiana |
| title_full | Coordinated recruitment of conserved defense-signaling pathways in PVYO-Infected Nicotiana benthamiana |
| title_fullStr | Coordinated recruitment of conserved defense-signaling pathways in PVYO-Infected Nicotiana benthamiana |
| title_full_unstemmed | Coordinated recruitment of conserved defense-signaling pathways in PVYO-Infected Nicotiana benthamiana |
| title_short | Coordinated recruitment of conserved defense-signaling pathways in PVYO-Infected Nicotiana benthamiana |
| title_sort | coordinated recruitment of conserved defense signaling pathways in pvyo infected nicotiana benthamiana |
| topic | antioxidant defense potyvirus ros atg4 atg8 |
| url | http://dx.doi.org/10.1080/15592324.2023.2252972 |
| work_keys_str_mv | AT wonjinkim coordinatedrecruitmentofconserveddefensesignalingpathwaysinpvyoinfectednicotianabenthamiana AT woongkim coordinatedrecruitmentofconserveddefensesignalingpathwaysinpvyoinfectednicotianabenthamiana AT youngsoonkim coordinatedrecruitmentofconserveddefensesignalingpathwaysinpvyoinfectednicotianabenthamiana AT hyeonsookcheong coordinatedrecruitmentofconserveddefensesignalingpathwaysinpvyoinfectednicotianabenthamiana AT seokjunkim coordinatedrecruitmentofconserveddefensesignalingpathwaysinpvyoinfectednicotianabenthamiana |