Association between vitamin D level and pediatric inflammatory bowel disease: A systematic review and meta-analysis
BackgroundPrevious studies have reported that the incidence of pediatric inflammatory bowel disease (IBD) is related to vitamin D, but it is still unclear. This study intends to calculate the relationship between pediatric IBD and vitamin D.MethodsA comprehensive literature search from inception to...
| Main Authors: | , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Frontiers Media S.A.
2023-04-01
|
| Series: | Frontiers in Pediatrics |
| Subjects: | |
| Online Access: | https://www.frontiersin.org/articles/10.3389/fped.2023.1155004/full |
| _version_ | 1827960884604960768 |
|---|---|
| author | Yan-hong Sun Dan-dan Tian Jian-ming Zhou Qing Ye |
| author_facet | Yan-hong Sun Dan-dan Tian Jian-ming Zhou Qing Ye |
| author_sort | Yan-hong Sun |
| collection | DOAJ |
| description | BackgroundPrevious studies have reported that the incidence of pediatric inflammatory bowel disease (IBD) is related to vitamin D, but it is still unclear. This study intends to calculate the relationship between pediatric IBD and vitamin D.MethodsA comprehensive literature search from inception to January 2023 was performed in the PubMed, EMBASE, Medline, Web of Science, and Google Scholar databases. Relevant data were extracted as required and used for subsequent calculations.ResultsSixteen papers were included, and there was no significant difference between the average vitamin D level in IBD patients and healthy controls. In addition, the overall pooled results showed that C-reactive protein (CRP) was 2.65 higher before vitamin D supplementation than after supplementation [SMD = 2.65, 95% CI = (2.26, 3.04)]. Moreover, patients with IBD in remission were 0.72 higher before vitamin D supplementation than after supplementation [OR = 0.72, 95% CI = (0.52, 1.00)].ConclusionThis study suggested that there was no obvious relationship between pediatric IBD and vitamin D, while vitamin D supplementation can improve disease activity. Therefore, follow-up still needs many prospective studies to confirm the relationship between pediatric IBD and vitamin D. |
| first_indexed | 2024-04-09T16:16:56Z |
| format | Article |
| id | doaj.art-5a5fd163b10c432685777cc04e3b19e3 |
| institution | Directory Open Access Journal |
| issn | 2296-2360 |
| language | English |
| last_indexed | 2024-04-09T16:16:56Z |
| publishDate | 2023-04-01 |
| publisher | Frontiers Media S.A. |
| record_format | Article |
| series | Frontiers in Pediatrics |
| spelling | doaj.art-5a5fd163b10c432685777cc04e3b19e32023-04-24T04:28:57ZengFrontiers Media S.A.Frontiers in Pediatrics2296-23602023-04-011110.3389/fped.2023.11550041155004Association between vitamin D level and pediatric inflammatory bowel disease: A systematic review and meta-analysisYan-hong SunDan-dan TianJian-ming ZhouQing YeBackgroundPrevious studies have reported that the incidence of pediatric inflammatory bowel disease (IBD) is related to vitamin D, but it is still unclear. This study intends to calculate the relationship between pediatric IBD and vitamin D.MethodsA comprehensive literature search from inception to January 2023 was performed in the PubMed, EMBASE, Medline, Web of Science, and Google Scholar databases. Relevant data were extracted as required and used for subsequent calculations.ResultsSixteen papers were included, and there was no significant difference between the average vitamin D level in IBD patients and healthy controls. In addition, the overall pooled results showed that C-reactive protein (CRP) was 2.65 higher before vitamin D supplementation than after supplementation [SMD = 2.65, 95% CI = (2.26, 3.04)]. Moreover, patients with IBD in remission were 0.72 higher before vitamin D supplementation than after supplementation [OR = 0.72, 95% CI = (0.52, 1.00)].ConclusionThis study suggested that there was no obvious relationship between pediatric IBD and vitamin D, while vitamin D supplementation can improve disease activity. Therefore, follow-up still needs many prospective studies to confirm the relationship between pediatric IBD and vitamin D.https://www.frontiersin.org/articles/10.3389/fped.2023.1155004/full25-hydroxyvitamin Dmeta-analysispediatric inflammatory bowel diseasevitamin Dc-Reactive protein |
| spellingShingle | Yan-hong Sun Dan-dan Tian Jian-ming Zhou Qing Ye Association between vitamin D level and pediatric inflammatory bowel disease: A systematic review and meta-analysis Frontiers in Pediatrics 25-hydroxyvitamin D meta-analysis pediatric inflammatory bowel disease vitamin D c-Reactive protein |
| title | Association between vitamin D level and pediatric inflammatory bowel disease: A systematic review and meta-analysis |
| title_full | Association between vitamin D level and pediatric inflammatory bowel disease: A systematic review and meta-analysis |
| title_fullStr | Association between vitamin D level and pediatric inflammatory bowel disease: A systematic review and meta-analysis |
| title_full_unstemmed | Association between vitamin D level and pediatric inflammatory bowel disease: A systematic review and meta-analysis |
| title_short | Association between vitamin D level and pediatric inflammatory bowel disease: A systematic review and meta-analysis |
| title_sort | association between vitamin d level and pediatric inflammatory bowel disease a systematic review and meta analysis |
| topic | 25-hydroxyvitamin D meta-analysis pediatric inflammatory bowel disease vitamin D c-Reactive protein |
| url | https://www.frontiersin.org/articles/10.3389/fped.2023.1155004/full |
| work_keys_str_mv | AT yanhongsun associationbetweenvitamindlevelandpediatricinflammatoryboweldiseaseasystematicreviewandmetaanalysis AT dandantian associationbetweenvitamindlevelandpediatricinflammatoryboweldiseaseasystematicreviewandmetaanalysis AT jianmingzhou associationbetweenvitamindlevelandpediatricinflammatoryboweldiseaseasystematicreviewandmetaanalysis AT qingye associationbetweenvitamindlevelandpediatricinflammatoryboweldiseaseasystematicreviewandmetaanalysis |