TOI-5205b: A Short-period Jovian Planet Transiting a Mid-M Dwarf
We present the discovery of TOI-5205b, a transiting Jovian planet orbiting a solar metallicity M4V star, which was discovered using Transiting Exoplanet Survey Satellite photometry and then confirmed using a combination of precise radial velocities, ground-based photometry, spectra, and speckle imag...
| Main Authors: | , , , , , , , , , , , , , , , , , , , , , , , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
IOP Publishing
2023-01-01
|
| Series: | The Astronomical Journal |
| Subjects: | |
| Online Access: | https://doi.org/10.3847/1538-3881/acabce |
| _version_ | 1797701459874152448 |
|---|---|
| author | Shubham Kanodia Suvrath Mahadevan Jessica Libby-Roberts Gudmundur Stefansson Caleb I. Cañas Anjali A. A. Piette Alan Boss Johanna Teske John Chambers Greg Zeimann Andrew Monson Paul Robertson Joe P. Ninan Andrea S. J. Lin Chad F. Bender William D. Cochran Scott A. Diddams Arvind F. Gupta Samuel Halverson Suzanne Hawley Henry A. Kobulnicky Andrew J. Metcalf Brock A. Parker Luke Powers Lawrence W. Ramsey Arpita Roy Christian Schwab Tera N. Swaby Ryan C. Terrien John Wisniewski |
| author_facet | Shubham Kanodia Suvrath Mahadevan Jessica Libby-Roberts Gudmundur Stefansson Caleb I. Cañas Anjali A. A. Piette Alan Boss Johanna Teske John Chambers Greg Zeimann Andrew Monson Paul Robertson Joe P. Ninan Andrea S. J. Lin Chad F. Bender William D. Cochran Scott A. Diddams Arvind F. Gupta Samuel Halverson Suzanne Hawley Henry A. Kobulnicky Andrew J. Metcalf Brock A. Parker Luke Powers Lawrence W. Ramsey Arpita Roy Christian Schwab Tera N. Swaby Ryan C. Terrien John Wisniewski |
| author_sort | Shubham Kanodia |
| collection | DOAJ |
| description | We present the discovery of TOI-5205b, a transiting Jovian planet orbiting a solar metallicity M4V star, which was discovered using Transiting Exoplanet Survey Satellite photometry and then confirmed using a combination of precise radial velocities, ground-based photometry, spectra, and speckle imaging. TOI-5205b has one of the highest mass ratios for M-dwarf planets, with a mass ratio of almost 0.3%, as it orbits a host star that is just 0.392 ± 0.015 M _⊙ . Its planetary radius is 1.03 ± 0.03 R _J , while the mass is 1.08 ± 0.06 M _J . Additionally, the large size of the planet orbiting a small star results in a transit depth of ∼7%, making it one of the deepest transits of a confirmed exoplanet orbiting a main-sequence star. The large transit depth makes TOI-5205b a compelling target to probe its atmospheric properties, as a means of tracing the potential formation pathways. While there have been radial-velocity-only discoveries of giant planets around mid-M dwarfs, this is the first transiting Jupiter with a mass measurement discovered around such a low-mass host star. The high mass of TOI-5205b stretches conventional theories of planet formation and disk scaling relations that cannot easily recreate the conditions required to form such planets. |
| first_indexed | 2024-03-12T04:36:56Z |
| format | Article |
| id | doaj.art-5a9ceb4272e847f6841d1186f639dca3 |
| institution | Directory Open Access Journal |
| issn | 1538-3881 |
| language | English |
| last_indexed | 2024-03-12T04:36:56Z |
| publishDate | 2023-01-01 |
| publisher | IOP Publishing |
| record_format | Article |
| series | The Astronomical Journal |
| spelling | doaj.art-5a9ceb4272e847f6841d1186f639dca32023-09-03T09:55:19ZengIOP PublishingThe Astronomical Journal1538-38812023-01-01165312010.3847/1538-3881/acabceTOI-5205b: A Short-period Jovian Planet Transiting a Mid-M DwarfShubham Kanodia0https://orcid.org/0000-0001-8401-4300Suvrath Mahadevan1https://orcid.org/0000-0001-9596-7983Jessica Libby-Roberts2https://orcid.org/0000-0002-2990-7613Gudmundur Stefansson3https://orcid.org/0000-0001-7409-5688Caleb I. Cañas4https://orcid.org/0000-0003-4835-0619Anjali A. A. Piette5https://orcid.org/0000-0002-4487-5533Alan Boss6https://orcid.org/0000-0001-7119-1105Johanna Teske7John Chambers8https://orcid.org/0000-0001-9046-2265Greg Zeimann9https://orcid.org/0000-0003-2307-0629Andrew Monson10https://orcid.org/0000-0002-0048-2586Paul Robertson11https://orcid.org/0000-0003-0149-9678Joe P. Ninan12https://orcid.org/0000-0001-8720-5612Andrea S. J. Lin13https://orcid.org/0000-0002-9082-6337Chad F. Bender14https://orcid.org/0000-0003-4384-7220William D. Cochran15https://orcid.org/0000-0001-9662-3496Scott A. Diddams16https://orcid.org/0000-0002-2144-0764Arvind F. Gupta17https://orcid.org/0000-0002-5463-9980Samuel Halverson18https://orcid.org/0000-0003-1312-9391Suzanne Hawley19https://orcid.org/0000-0002-6629-4182Henry A. Kobulnicky20https://orcid.org/0000-0002-4475-4176Andrew J. Metcalf21https://orcid.org/0000-0001-5000-1018Brock A. Parker22https://orcid.org/0000-0001-9307-8170Luke Powers23https://orcid.org/0000-0002-5300-5353Lawrence W. Ramsey24https://orcid.org/0000-0002-4289-7958Arpita Roy25https://orcid.org/0000-0001-8127-5775Christian Schwab26https://orcid.org/0000-0002-0091-7105Tera N. Swaby27https://orcid.org/0000-0002-5817-202XRyan C. Terrien28https://orcid.org/0000-0002-4788-8858John Wisniewski29https://orcid.org/0000-0001-9209-1808Earth and Planets Laboratory, Carnegie Institution for Science , 5241 Broad Branch Road, NW, Washington, DC 20015, USA ; shbhuk@gmail.com; Department of Astronomy & Astrophysics, 525 Davey Laboratory, The Pennsylvania State University , University Park, PA 16802, USA; Center for Exoplanets and Habitable Worlds, 525 Davey Laboratory, The Pennsylvania State University , University Park, PA 16802, USADepartment of Astronomy & Astrophysics, 525 Davey Laboratory, The Pennsylvania State University , University Park, PA 16802, USA; Center for Exoplanets and Habitable Worlds, 525 Davey Laboratory, The Pennsylvania State University , University Park, PA 16802, USA; ETH Zurich, Institute for Particle Physics & Astrophysics , SwitzerlandDepartment of Astronomy & Astrophysics, 525 Davey Laboratory, The Pennsylvania State University , University Park, PA 16802, USA; Center for Exoplanets and Habitable Worlds, 525 Davey Laboratory, The Pennsylvania State University , University Park, PA 16802, USADepartment of Astrophysical Sciences, Princeton University , 4 Ivy Lane, Princeton, NJ 08540, USADepartment of Astronomy & Astrophysics, 525 Davey Laboratory, The Pennsylvania State University , University Park, PA 16802, USA; Center for Exoplanets and Habitable Worlds, 525 Davey Laboratory, The Pennsylvania State University , University Park, PA 16802, USA; NASA Goddard Space Flight Center , 8800 Greenbelt Road, Greenbelt, MD 20771, USAEarth and Planets Laboratory, Carnegie Institution for Science , 5241 Broad Branch Road, NW, Washington, DC 20015, USA ; shbhuk@gmail.comEarth and Planets Laboratory, Carnegie Institution for Science , 5241 Broad Branch Road, NW, Washington, DC 20015, USA ; shbhuk@gmail.comEarth and Planets Laboratory, Carnegie Institution for Science , 5241 Broad Branch Road, NW, Washington, DC 20015, USA ; shbhuk@gmail.comEarth and Planets Laboratory, Carnegie Institution for Science , 5241 Broad Branch Road, NW, Washington, DC 20015, USA ; shbhuk@gmail.comHobby Eberly Telescope, University of Texas , Austin, Austin, TX 78712, USASteward Observatory, The University of Arizona , 933 N. Cherry Avenue, Tucson, AZ 85721, USADepartment of Physics & Astronomy, University of California Irvine , Irvine, CA 92697, USADepartment of Astronomy and Astrophysics, Tata Institute of Fundamental Research , Homi Bhabha Road, Colaba, Mumbai 400005, IndiaDepartment of Astronomy & Astrophysics, 525 Davey Laboratory, The Pennsylvania State University , University Park, PA 16802, USA; Center for Exoplanets and Habitable Worlds, 525 Davey Laboratory, The Pennsylvania State University , University Park, PA 16802, USASteward Observatory, The University of Arizona , 933 N. Cherry Avenue, Tucson, AZ 85721, USAMcDonald Observatory and Department of Astronomy, The University of Texas at Austin , USA; Center for Planetary Systems Habitability, The University of Texas at Austin , USAElectrical, Computer & Energy Engineering, University of Colorado , 425 UCB, Boulder, CO 80309, USA; Department of Physics, University of Colorado , 2000 Colorado Avenue, Boulder, CO 80309, USA; Time and Frequency Division, National Institute of Standards and Technology , 325 Broadway, Boulder, CO 80305, USADepartment of Astronomy & Astrophysics, 525 Davey Laboratory, The Pennsylvania State University , University Park, PA 16802, USA; Center for Exoplanets and Habitable Worlds, 525 Davey Laboratory, The Pennsylvania State University , University Park, PA 16802, USAJet Propulsion Laboratory , 4800 Oak Grove Drive, Pasadena, CA 91109, USADepartment of Astronomy, Box 351580, University of Washington , Seattle, WA 98195, USADepartment of Physics & Astronomy, University of Wyoming , Laramie, WY 82070, USASpace Vehicles Directorate, Air Force Research Laboratory , 3550 Aberdeen Avenue SE, Kirtland AFB, NM 87117, USADepartment of Physics & Astronomy, University of Wyoming , Laramie, WY 82070, USADepartment of Astronomy & Astrophysics, 525 Davey Laboratory, The Pennsylvania State University , University Park, PA 16802, USA; Center for Exoplanets and Habitable Worlds, 525 Davey Laboratory, The Pennsylvania State University , University Park, PA 16802, USADepartment of Astronomy & Astrophysics, 525 Davey Laboratory, The Pennsylvania State University , University Park, PA 16802, USA; Center for Exoplanets and Habitable Worlds, 525 Davey Laboratory, The Pennsylvania State University , University Park, PA 16802, USASpace Telescope Science Institute , 3700 San Martin Drive, Baltimore, MD 21218, USA; Department of Physics and Astronomy, Johns Hopkins University , 3400 N Charles Street, Baltimore, MD 21218, USASchool of Mathematical and Physical Sciences, Macquarie University , Balaclava Road, North Ryde, NSW 2109, AustraliaDepartment of Physics & Astronomy, University of Wyoming , Laramie, WY 82070, USACarleton College , One North College Street, Northfield, MN 55057, USADepartment of Physics & Astronomy, George Mason University , 4400 University Drive, MS 3F3, Fairfax, VA 22030, USAWe present the discovery of TOI-5205b, a transiting Jovian planet orbiting a solar metallicity M4V star, which was discovered using Transiting Exoplanet Survey Satellite photometry and then confirmed using a combination of precise radial velocities, ground-based photometry, spectra, and speckle imaging. TOI-5205b has one of the highest mass ratios for M-dwarf planets, with a mass ratio of almost 0.3%, as it orbits a host star that is just 0.392 ± 0.015 M _⊙ . Its planetary radius is 1.03 ± 0.03 R _J , while the mass is 1.08 ± 0.06 M _J . Additionally, the large size of the planet orbiting a small star results in a transit depth of ∼7%, making it one of the deepest transits of a confirmed exoplanet orbiting a main-sequence star. The large transit depth makes TOI-5205b a compelling target to probe its atmospheric properties, as a means of tracing the potential formation pathways. While there have been radial-velocity-only discoveries of giant planets around mid-M dwarfs, this is the first transiting Jupiter with a mass measurement discovered around such a low-mass host star. The high mass of TOI-5205b stretches conventional theories of planet formation and disk scaling relations that cannot easily recreate the conditions required to form such planets.https://doi.org/10.3847/1538-3881/acabceRadial velocityM dwarf starsExtrasolar gaseous giant planetsTransits |
| spellingShingle | Shubham Kanodia Suvrath Mahadevan Jessica Libby-Roberts Gudmundur Stefansson Caleb I. Cañas Anjali A. A. Piette Alan Boss Johanna Teske John Chambers Greg Zeimann Andrew Monson Paul Robertson Joe P. Ninan Andrea S. J. Lin Chad F. Bender William D. Cochran Scott A. Diddams Arvind F. Gupta Samuel Halverson Suzanne Hawley Henry A. Kobulnicky Andrew J. Metcalf Brock A. Parker Luke Powers Lawrence W. Ramsey Arpita Roy Christian Schwab Tera N. Swaby Ryan C. Terrien John Wisniewski TOI-5205b: A Short-period Jovian Planet Transiting a Mid-M Dwarf The Astronomical Journal Radial velocity M dwarf stars Extrasolar gaseous giant planets Transits |
| title | TOI-5205b: A Short-period Jovian Planet Transiting a Mid-M Dwarf |
| title_full | TOI-5205b: A Short-period Jovian Planet Transiting a Mid-M Dwarf |
| title_fullStr | TOI-5205b: A Short-period Jovian Planet Transiting a Mid-M Dwarf |
| title_full_unstemmed | TOI-5205b: A Short-period Jovian Planet Transiting a Mid-M Dwarf |
| title_short | TOI-5205b: A Short-period Jovian Planet Transiting a Mid-M Dwarf |
| title_sort | toi 5205b a short period jovian planet transiting a mid m dwarf |
| topic | Radial velocity M dwarf stars Extrasolar gaseous giant planets Transits |
| url | https://doi.org/10.3847/1538-3881/acabce |
| work_keys_str_mv | AT shubhamkanodia toi5205bashortperiodjovianplanettransitingamidmdwarf AT suvrathmahadevan toi5205bashortperiodjovianplanettransitingamidmdwarf AT jessicalibbyroberts toi5205bashortperiodjovianplanettransitingamidmdwarf AT gudmundurstefansson toi5205bashortperiodjovianplanettransitingamidmdwarf AT calebicanas toi5205bashortperiodjovianplanettransitingamidmdwarf AT anjaliaapiette toi5205bashortperiodjovianplanettransitingamidmdwarf AT alanboss toi5205bashortperiodjovianplanettransitingamidmdwarf AT johannateske toi5205bashortperiodjovianplanettransitingamidmdwarf AT johnchambers toi5205bashortperiodjovianplanettransitingamidmdwarf AT gregzeimann toi5205bashortperiodjovianplanettransitingamidmdwarf AT andrewmonson toi5205bashortperiodjovianplanettransitingamidmdwarf AT paulrobertson toi5205bashortperiodjovianplanettransitingamidmdwarf AT joepninan toi5205bashortperiodjovianplanettransitingamidmdwarf AT andreasjlin toi5205bashortperiodjovianplanettransitingamidmdwarf AT chadfbender toi5205bashortperiodjovianplanettransitingamidmdwarf AT williamdcochran toi5205bashortperiodjovianplanettransitingamidmdwarf AT scottadiddams toi5205bashortperiodjovianplanettransitingamidmdwarf AT arvindfgupta toi5205bashortperiodjovianplanettransitingamidmdwarf AT samuelhalverson toi5205bashortperiodjovianplanettransitingamidmdwarf AT suzannehawley toi5205bashortperiodjovianplanettransitingamidmdwarf AT henryakobulnicky toi5205bashortperiodjovianplanettransitingamidmdwarf AT andrewjmetcalf toi5205bashortperiodjovianplanettransitingamidmdwarf AT brockaparker toi5205bashortperiodjovianplanettransitingamidmdwarf AT lukepowers toi5205bashortperiodjovianplanettransitingamidmdwarf AT lawrencewramsey toi5205bashortperiodjovianplanettransitingamidmdwarf AT arpitaroy toi5205bashortperiodjovianplanettransitingamidmdwarf AT christianschwab toi5205bashortperiodjovianplanettransitingamidmdwarf AT teranswaby toi5205bashortperiodjovianplanettransitingamidmdwarf AT ryancterrien toi5205bashortperiodjovianplanettransitingamidmdwarf AT johnwisniewski toi5205bashortperiodjovianplanettransitingamidmdwarf |