Otizm Spektrum Bozukluğu Olan 6 Yaşından Küçük Erkekler Çocuklarda Serum S100B Düzeylerinin Değerlendirilmesi: Psikiyatrik ve Biyokimyasal Perspektif
Aim: Autism spectrum disorder is a neurodevelopmental disorder. The S100 calcium binding protein B (S100B) is among the markers of astrocyte activation as well as brain damage. Herein, it was aimed to evaluate S100B levels to determine whether there is a relation with the severity of autism spectrum...
| Main Authors: | , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Duzce University
2021-12-01
|
| Series: | Düzce Tıp Fakültesi Dergisi |
| Subjects: | |
| Online Access: | https://dergipark.org.tr/en/download/article-file/1898015 |
| _version_ | 1827608452005888000 |
|---|---|
| author | Özge Demircan Şahin Bodur İbrahim Durukan Ayşe Nihal Eraslan |
| author_facet | Özge Demircan Şahin Bodur İbrahim Durukan Ayşe Nihal Eraslan |
| author_sort | Özge Demircan |
| collection | DOAJ |
| description | Aim: Autism spectrum disorder is a neurodevelopmental disorder. The S100 calcium binding protein B (S100B) is among the markers of astrocyte activation as well as brain damage. Herein, it was aimed to evaluate S100B levels to determine whether there is a relation with the severity of autism spectrum disorder and establish possible causes of different results among the studies in the literature from a psychiatric and biochemical perspective.
Material and Methods: Twenty-five male children with autism spectrum disorder were included as the study group along with twenty-seven male children as the control group. The childhood autism rating scale and the autism behavior checklist were applied. Serum S100B protein levels were measured by enzyme-linked immunosorbent assay (ELISA).
Results: The mean serum S100B level was 1008.61±171.34 pg/mL in the study group and 1060.14±182.83 pg/mL in the control group, and no statistically significant difference was found between the groups (p=0.300). Based on the childhood autism rating scale scores, 60% (n=15) of the children with autism spectrum disorder had severe autism, whereas 40% (n=10) had mild-to-moderate autism. There was no significant difference in terms of the serum S100B levels between the groups of autism spectrum disorder severity (p=0.935) or according to the autistic regression status (p=0.667).
Conclusion: For S100B to be accepted as a reliable biomarker for autism spectrum disorder, more studies considering some factors with larger samples should be performed. Moreover, to understand the effect of biochemical methodology on the results, further studies are suggested on this subject. |
| first_indexed | 2024-03-09T07:12:18Z |
| format | Article |
| id | doaj.art-611ab54466a74631b3038c97d5338303 |
| institution | Directory Open Access Journal |
| issn | 1307-671X |
| language | English |
| last_indexed | 2024-03-09T07:12:18Z |
| publishDate | 2021-12-01 |
| publisher | Duzce University |
| record_format | Article |
| series | Düzce Tıp Fakültesi Dergisi |
| spelling | doaj.art-611ab54466a74631b3038c97d53383032023-12-03T09:00:13ZengDuzce UniversityDüzce Tıp Fakültesi Dergisi1307-671X2021-12-0123326326910.18678/dtfd.97602197Otizm Spektrum Bozukluğu Olan 6 Yaşından Küçük Erkekler Çocuklarda Serum S100B Düzeylerinin Değerlendirilmesi: Psikiyatrik ve Biyokimyasal PerspektifÖzge Demircan0Şahin Bodur1İbrahim Durukan2Ayşe Nihal Eraslan3Balıkesir Atatürk Şehir HastanesiGülhane Eğitim ve Araştırma HastanesiGülhane Eğitim ve Araştırma HastanesiAnkara Training and Education HospitalAim: Autism spectrum disorder is a neurodevelopmental disorder. The S100 calcium binding protein B (S100B) is among the markers of astrocyte activation as well as brain damage. Herein, it was aimed to evaluate S100B levels to determine whether there is a relation with the severity of autism spectrum disorder and establish possible causes of different results among the studies in the literature from a psychiatric and biochemical perspective. Material and Methods: Twenty-five male children with autism spectrum disorder were included as the study group along with twenty-seven male children as the control group. The childhood autism rating scale and the autism behavior checklist were applied. Serum S100B protein levels were measured by enzyme-linked immunosorbent assay (ELISA). Results: The mean serum S100B level was 1008.61±171.34 pg/mL in the study group and 1060.14±182.83 pg/mL in the control group, and no statistically significant difference was found between the groups (p=0.300). Based on the childhood autism rating scale scores, 60% (n=15) of the children with autism spectrum disorder had severe autism, whereas 40% (n=10) had mild-to-moderate autism. There was no significant difference in terms of the serum S100B levels between the groups of autism spectrum disorder severity (p=0.935) or according to the autistic regression status (p=0.667). Conclusion: For S100B to be accepted as a reliable biomarker for autism spectrum disorder, more studies considering some factors with larger samples should be performed. Moreover, to understand the effect of biochemical methodology on the results, further studies are suggested on this subject.https://dergipark.org.tr/en/download/article-file/1898015otizm spektrum bozukluğuotizms100bnöroglial hücrelerautism spectrum disorderautisms100bneuroglial cells |
| spellingShingle | Özge Demircan Şahin Bodur İbrahim Durukan Ayşe Nihal Eraslan Otizm Spektrum Bozukluğu Olan 6 Yaşından Küçük Erkekler Çocuklarda Serum S100B Düzeylerinin Değerlendirilmesi: Psikiyatrik ve Biyokimyasal Perspektif Düzce Tıp Fakültesi Dergisi otizm spektrum bozukluğu otizm s100b nöroglial hücreler autism spectrum disorder autism s100b neuroglial cells |
| title | Otizm Spektrum Bozukluğu Olan 6 Yaşından Küçük Erkekler Çocuklarda Serum S100B Düzeylerinin Değerlendirilmesi: Psikiyatrik ve Biyokimyasal Perspektif |
| title_full | Otizm Spektrum Bozukluğu Olan 6 Yaşından Küçük Erkekler Çocuklarda Serum S100B Düzeylerinin Değerlendirilmesi: Psikiyatrik ve Biyokimyasal Perspektif |
| title_fullStr | Otizm Spektrum Bozukluğu Olan 6 Yaşından Küçük Erkekler Çocuklarda Serum S100B Düzeylerinin Değerlendirilmesi: Psikiyatrik ve Biyokimyasal Perspektif |
| title_full_unstemmed | Otizm Spektrum Bozukluğu Olan 6 Yaşından Küçük Erkekler Çocuklarda Serum S100B Düzeylerinin Değerlendirilmesi: Psikiyatrik ve Biyokimyasal Perspektif |
| title_short | Otizm Spektrum Bozukluğu Olan 6 Yaşından Küçük Erkekler Çocuklarda Serum S100B Düzeylerinin Değerlendirilmesi: Psikiyatrik ve Biyokimyasal Perspektif |
| title_sort | otizm spektrum bozuklugu olan 6 yasindan kucuk erkekler cocuklarda serum s100b duzeylerinin degerlendirilmesi psikiyatrik ve biyokimyasal perspektif |
| topic | otizm spektrum bozukluğu otizm s100b nöroglial hücreler autism spectrum disorder autism s100b neuroglial cells |
| url | https://dergipark.org.tr/en/download/article-file/1898015 |
| work_keys_str_mv | AT ozgedemircan otizmspektrumbozukluguolan6yasındankucukerkeklercocuklardaserums100bduzeylerinindegerlendirilmesipsikiyatrikvebiyokimyasalperspektif AT sahinbodur otizmspektrumbozukluguolan6yasındankucukerkeklercocuklardaserums100bduzeylerinindegerlendirilmesipsikiyatrikvebiyokimyasalperspektif AT ibrahimdurukan otizmspektrumbozukluguolan6yasındankucukerkeklercocuklardaserums100bduzeylerinindegerlendirilmesipsikiyatrikvebiyokimyasalperspektif AT aysenihaleraslan otizmspektrumbozukluguolan6yasındankucukerkeklercocuklardaserums100bduzeylerinindegerlendirilmesipsikiyatrikvebiyokimyasalperspektif |