Genetic Mechanisms of Vancomycin Resistance in <i>Clostridioides difficile</i>: A Systematic Review
Antimicrobial resistance to treatments for <i>Clostridioides difficile</i> infection (CDI) poses a significant threat to global health. <i>C. difficile</i> is widely thought to be susceptible to oral vancomycin, which is increasingly the mainstay of CDI treatment. However, cl...
| Main Authors: | , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
MDPI AG
2022-02-01
|
| Series: | Antibiotics |
| Subjects: | |
| Online Access: | https://www.mdpi.com/2079-6382/11/2/258 |
| _version_ | 1797483331679420416 |
|---|---|
| author | Taryn A. Eubank Anne J. Gonzales-Luna Julian G. Hurdle Kevin W. Garey |
| author_facet | Taryn A. Eubank Anne J. Gonzales-Luna Julian G. Hurdle Kevin W. Garey |
| author_sort | Taryn A. Eubank |
| collection | DOAJ |
| description | Antimicrobial resistance to treatments for <i>Clostridioides difficile</i> infection (CDI) poses a significant threat to global health. <i>C. difficile</i> is widely thought to be susceptible to oral vancomycin, which is increasingly the mainstay of CDI treatment. However, clinical labs do not conduct <i>C. difficile</i> susceptibility testing, presenting a challenge to detecting the emergence and impact of resistance. In this systematic review, we describe gene determinants and associated clinical and laboratory mechanisms of vancomycin resistance in <i>C. difficile</i>, including drug-binding site alterations, efflux pumps, RNA polymerase mutations, and biofilm formation. Additional research is needed to further characterize these mechanisms and understand their clinical impact. |
| first_indexed | 2024-03-09T22:46:25Z |
| format | Article |
| id | doaj.art-638c575b060a42808da420be563e2008 |
| institution | Directory Open Access Journal |
| issn | 2079-6382 |
| language | English |
| last_indexed | 2024-03-09T22:46:25Z |
| publishDate | 2022-02-01 |
| publisher | MDPI AG |
| record_format | Article |
| series | Antibiotics |
| spelling | doaj.art-638c575b060a42808da420be563e20082023-11-23T18:29:09ZengMDPI AGAntibiotics2079-63822022-02-0111225810.3390/antibiotics11020258Genetic Mechanisms of Vancomycin Resistance in <i>Clostridioides difficile</i>: A Systematic ReviewTaryn A. Eubank0Anne J. Gonzales-Luna1Julian G. Hurdle2Kevin W. Garey3Department of Pharmacy Practice and Translational Research, University of Houston College of Pharmacy, Houston, TX 77204, USADepartment of Pharmacy Practice and Translational Research, University of Houston College of Pharmacy, Houston, TX 77204, USACenter of Infectious and Inflammatory Diseases, Institute of Biosciences and Technology, TX A&M Health Science Center, Houston, TX 77030, USADepartment of Pharmacy Practice and Translational Research, University of Houston College of Pharmacy, Houston, TX 77204, USAAntimicrobial resistance to treatments for <i>Clostridioides difficile</i> infection (CDI) poses a significant threat to global health. <i>C. difficile</i> is widely thought to be susceptible to oral vancomycin, which is increasingly the mainstay of CDI treatment. However, clinical labs do not conduct <i>C. difficile</i> susceptibility testing, presenting a challenge to detecting the emergence and impact of resistance. In this systematic review, we describe gene determinants and associated clinical and laboratory mechanisms of vancomycin resistance in <i>C. difficile</i>, including drug-binding site alterations, efflux pumps, RNA polymerase mutations, and biofilm formation. Additional research is needed to further characterize these mechanisms and understand their clinical impact.https://www.mdpi.com/2079-6382/11/2/258<i>Clostridium difficile</i>antimicrobial resistancereduced susceptibility<i>van</i> genesplasmidsefflux pumps |
| spellingShingle | Taryn A. Eubank Anne J. Gonzales-Luna Julian G. Hurdle Kevin W. Garey Genetic Mechanisms of Vancomycin Resistance in <i>Clostridioides difficile</i>: A Systematic Review Antibiotics <i>Clostridium difficile</i> antimicrobial resistance reduced susceptibility <i>van</i> genes plasmids efflux pumps |
| title | Genetic Mechanisms of Vancomycin Resistance in <i>Clostridioides difficile</i>: A Systematic Review |
| title_full | Genetic Mechanisms of Vancomycin Resistance in <i>Clostridioides difficile</i>: A Systematic Review |
| title_fullStr | Genetic Mechanisms of Vancomycin Resistance in <i>Clostridioides difficile</i>: A Systematic Review |
| title_full_unstemmed | Genetic Mechanisms of Vancomycin Resistance in <i>Clostridioides difficile</i>: A Systematic Review |
| title_short | Genetic Mechanisms of Vancomycin Resistance in <i>Clostridioides difficile</i>: A Systematic Review |
| title_sort | genetic mechanisms of vancomycin resistance in i clostridioides difficile i a systematic review |
| topic | <i>Clostridium difficile</i> antimicrobial resistance reduced susceptibility <i>van</i> genes plasmids efflux pumps |
| url | https://www.mdpi.com/2079-6382/11/2/258 |
| work_keys_str_mv | AT tarynaeubank geneticmechanismsofvancomycinresistanceiniclostridioidesdifficileiasystematicreview AT annejgonzalesluna geneticmechanismsofvancomycinresistanceiniclostridioidesdifficileiasystematicreview AT julianghurdle geneticmechanismsofvancomycinresistanceiniclostridioidesdifficileiasystematicreview AT kevinwgarey geneticmechanismsofvancomycinresistanceiniclostridioidesdifficileiasystematicreview |