Heart Rate Variability and Coronary Artery Bypass Grafting: A Systematic Review
Background: Coronary artery bypass grafting (CABG) is a well-established surgical procedure used to treat significant coronary artery disease. Nevertheless, unfavorable cardiovascular events and complications, including cardiac arrhythmias may be observed in patients after CABG. Previous studies hav...
| Main Authors: | , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
IMR Press
2024-01-01
|
| Series: | Reviews in Cardiovascular Medicine |
| Subjects: | |
| Online Access: | https://www.imrpress.com/journal/RCM/25/1/10.31083/j.rcm2501036 |
| _version_ | 1797338481644535808 |
|---|---|
| author | Patrycja S. Matusik Omar Alomar Maryam Rafaqat Hussain Muhammad Akrmah Paweł T. Matusik Daniel M. Chen Muhammed Alomar Phyllis K. Stein |
| author_facet | Patrycja S. Matusik Omar Alomar Maryam Rafaqat Hussain Muhammad Akrmah Paweł T. Matusik Daniel M. Chen Muhammed Alomar Phyllis K. Stein |
| author_sort | Patrycja S. Matusik |
| collection | DOAJ |
| description | Background: Coronary artery bypass grafting (CABG) is a well-established surgical procedure used to treat significant coronary artery disease. Nevertheless, unfavorable cardiovascular events and complications, including cardiac arrhythmias may be observed in patients after CABG. Previous studies have revealed a relationship between risk of cardiac arrhythmias and abnormal heart rate variability (HRV), which reflects adverse alterations in cardiac autonomic functioning, that may occur in patients after a CABG procedure. The aim of this article was to provide a systematic review of the major research findings in this area. Methods: A literature search was carried out using PubMed, Cochrane, and Embase databases and relevant articles, published in English, were analyzed in detail. Results: Studies performed so far have shown time depending changes in HRV after CABG. Time and frequency domain HRV decrease acutely after CABG but recover almost completely to pre-operative values by 6 months after surgery. Some preoperative clinical states such as: heart failure, type 2 diabetes mellitus and depression adversely affect post-CABG HRV. Finally, post-CABG cardiac rehabilitation appears to improve exercise capacity and speed up recovery of HRV. Conclusions: Generally, traditional time and frequency domain HRV parameters fail to predict complications post-CABG. Altered non-linear measures of HRV may identify subgroups of subjects at increased risk of potential complications, including atrial fibrillation post-CABG. However, data available currently does not appear to unequivocally support the hypothesis that early HRV assessment in post-CABG patients predicts long-term mortality. |
| first_indexed | 2024-03-08T09:31:51Z |
| format | Article |
| id | doaj.art-64d9d676c3e94e52903b8c766e3b98f2 |
| institution | Directory Open Access Journal |
| issn | 1530-6550 |
| language | English |
| last_indexed | 2024-03-08T09:31:51Z |
| publishDate | 2024-01-01 |
| publisher | IMR Press |
| record_format | Article |
| series | Reviews in Cardiovascular Medicine |
| spelling | doaj.art-64d9d676c3e94e52903b8c766e3b98f22024-01-31T01:12:56ZengIMR PressReviews in Cardiovascular Medicine1530-65502024-01-012513610.31083/j.rcm2501036S1530-6550(23)01174-2Heart Rate Variability and Coronary Artery Bypass Grafting: A Systematic ReviewPatrycja S. Matusik0Omar Alomar1Maryam Rafaqat Hussain2Muhammad Akrmah3Paweł T. Matusik4Daniel M. Chen5Muhammed Alomar6Phyllis K. Stein7Chair of Radiology, Jagiellonian University Medical College and University Hospital, 30-688 Kraków, PolandHeart Rate Variability Laboratory, Cardiovascular Division, Department of Medicine, Washington University School of Medicine in St. Louis, Saint Louis, MO 63130, USAIcahn School of Medicine at Mount Sinai, New York, NY 10029, USADepartment of Pathology, Brigham and Women's Hospital, Boston, MA 02215, USADepartment of Electrocardiology, Institute of Cardiology, Faculty of Medicine, Jagiellonian University Medical College, 31-202 Kraków, PolandFeinberg School of Medicine, Northwestern University, Chicago, IL 60611, USAHeart Rate Variability Laboratory, Cardiovascular Division, Department of Medicine, Washington University School of Medicine in St. Louis, Saint Louis, MO 63130, USAHeart Rate Variability Laboratory, Cardiovascular Division, Department of Medicine, Washington University School of Medicine in St. Louis, Saint Louis, MO 63130, USABackground: Coronary artery bypass grafting (CABG) is a well-established surgical procedure used to treat significant coronary artery disease. Nevertheless, unfavorable cardiovascular events and complications, including cardiac arrhythmias may be observed in patients after CABG. Previous studies have revealed a relationship between risk of cardiac arrhythmias and abnormal heart rate variability (HRV), which reflects adverse alterations in cardiac autonomic functioning, that may occur in patients after a CABG procedure. The aim of this article was to provide a systematic review of the major research findings in this area. Methods: A literature search was carried out using PubMed, Cochrane, and Embase databases and relevant articles, published in English, were analyzed in detail. Results: Studies performed so far have shown time depending changes in HRV after CABG. Time and frequency domain HRV decrease acutely after CABG but recover almost completely to pre-operative values by 6 months after surgery. Some preoperative clinical states such as: heart failure, type 2 diabetes mellitus and depression adversely affect post-CABG HRV. Finally, post-CABG cardiac rehabilitation appears to improve exercise capacity and speed up recovery of HRV. Conclusions: Generally, traditional time and frequency domain HRV parameters fail to predict complications post-CABG. Altered non-linear measures of HRV may identify subgroups of subjects at increased risk of potential complications, including atrial fibrillation post-CABG. However, data available currently does not appear to unequivocally support the hypothesis that early HRV assessment in post-CABG patients predicts long-term mortality.https://www.imrpress.com/journal/RCM/25/1/10.31083/j.rcm2501036heart rate variabilitycoronary artery bypass grafting surgerymortalityatrial fibrillationrehabilitation |
| spellingShingle | Patrycja S. Matusik Omar Alomar Maryam Rafaqat Hussain Muhammad Akrmah Paweł T. Matusik Daniel M. Chen Muhammed Alomar Phyllis K. Stein Heart Rate Variability and Coronary Artery Bypass Grafting: A Systematic Review Reviews in Cardiovascular Medicine heart rate variability coronary artery bypass grafting surgery mortality atrial fibrillation rehabilitation |
| title | Heart Rate Variability and Coronary Artery Bypass Grafting: A Systematic Review |
| title_full | Heart Rate Variability and Coronary Artery Bypass Grafting: A Systematic Review |
| title_fullStr | Heart Rate Variability and Coronary Artery Bypass Grafting: A Systematic Review |
| title_full_unstemmed | Heart Rate Variability and Coronary Artery Bypass Grafting: A Systematic Review |
| title_short | Heart Rate Variability and Coronary Artery Bypass Grafting: A Systematic Review |
| title_sort | heart rate variability and coronary artery bypass grafting a systematic review |
| topic | heart rate variability coronary artery bypass grafting surgery mortality atrial fibrillation rehabilitation |
| url | https://www.imrpress.com/journal/RCM/25/1/10.31083/j.rcm2501036 |
| work_keys_str_mv | AT patrycjasmatusik heartratevariabilityandcoronaryarterybypassgraftingasystematicreview AT omaralomar heartratevariabilityandcoronaryarterybypassgraftingasystematicreview AT maryamrafaqathussain heartratevariabilityandcoronaryarterybypassgraftingasystematicreview AT muhammadakrmah heartratevariabilityandcoronaryarterybypassgraftingasystematicreview AT pawełtmatusik heartratevariabilityandcoronaryarterybypassgraftingasystematicreview AT danielmchen heartratevariabilityandcoronaryarterybypassgraftingasystematicreview AT muhammedalomar heartratevariabilityandcoronaryarterybypassgraftingasystematicreview AT phylliskstein heartratevariabilityandcoronaryarterybypassgraftingasystematicreview |