Gradual and Acute Temperature Rise Induces Crossing Endocrine, Metabolic, and Immunological Pathways in Maraena Whitefish (Coregonus maraena)
The complex and still poorly understood nature of thermoregulation in various fish species complicates the determination of the physiological status on the basis of diagnostic marker genes and indicative molecular pathways. The present study aimed to compare the physiological impacts of both gradual...
| Main Authors: | , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Frontiers Media S.A.
2018-07-01
|
| Series: | Frontiers in Genetics |
| Subjects: | |
| Online Access: | https://www.frontiersin.org/article/10.3389/fgene.2018.00241/full |
| _version_ | 1818189700387569664 |
|---|---|
| author | Alexander Rebl Marieke Verleih Mareen Nipkow Simone Altmann Ralf Bochert Tom Goldammer |
| author_facet | Alexander Rebl Marieke Verleih Mareen Nipkow Simone Altmann Ralf Bochert Tom Goldammer |
| author_sort | Alexander Rebl |
| collection | DOAJ |
| description | The complex and still poorly understood nature of thermoregulation in various fish species complicates the determination of the physiological status on the basis of diagnostic marker genes and indicative molecular pathways. The present study aimed to compare the physiological impacts of both gradual and acute temperature rise from 18 to 24°C on maraena whitefish in aquaculture. Microarray-based transcriptome profiles in the liver, spleen and kidney of heat-stressed maraena whitefish revealed the modulation of a significantly higher number of genes in those groups exposed to gradually rising temperatures compared with the acutely stressed groups, which might reflect early adaptation mechanisms. Moreover, we suggest a common set of 11 differentially expressed genes that indicate thermal stress induced by gradual or acute temperature rise in the three selected tissues. Besides the two pathways regulated in both data sets unfolded protein response and aldosterone signaling in epithelial cells, we identified unique tissue- and stress type-specific pathways reflecting the crossroads between signal transduction, metabolic and immunologic pathways to cope with thermal stress. In addition, comparing lists of differentially regulated genes with meta-analyzed published data sets revealed that “acute temperature rise”-responding genes that encode members of the HSP70, HSP90, and HSP40 families; their functional homologs; co-chaperones and stress-signal transducers are well-conserved across different species, tissues and/or cell types and experimental approaches. |
| first_indexed | 2024-12-11T23:46:59Z |
| format | Article |
| id | doaj.art-6607b32a26e7456b8d07d4594c9c24bb |
| institution | Directory Open Access Journal |
| issn | 1664-8021 |
| language | English |
| last_indexed | 2024-12-11T23:46:59Z |
| publishDate | 2018-07-01 |
| publisher | Frontiers Media S.A. |
| record_format | Article |
| series | Frontiers in Genetics |
| spelling | doaj.art-6607b32a26e7456b8d07d4594c9c24bb2022-12-22T00:45:36ZengFrontiers Media S.A.Frontiers in Genetics1664-80212018-07-01910.3389/fgene.2018.00241385060Gradual and Acute Temperature Rise Induces Crossing Endocrine, Metabolic, and Immunological Pathways in Maraena Whitefish (Coregonus maraena)Alexander Rebl0Marieke Verleih1Mareen Nipkow2Simone Altmann3Ralf Bochert4Tom Goldammer5Fish Genetics Unit, Institute of Genome Biology, Leibniz Institute for Farm Animal Biology (FBN), Dummerstorf, GermanyFish Genetics Unit, Institute of Genome Biology, Leibniz Institute for Farm Animal Biology (FBN), Dummerstorf, GermanyFish Genetics Unit, Institute of Genome Biology, Leibniz Institute for Farm Animal Biology (FBN), Dummerstorf, GermanyFish Genetics Unit, Institute of Genome Biology, Leibniz Institute for Farm Animal Biology (FBN), Dummerstorf, GermanyResearch Station Aquaculture Born, Institute of Fisheries, Mecklenburg-Vorpommern Research Centre for Agriculture and Fisheries (LFA MV), Born, GermanyFish Genetics Unit, Institute of Genome Biology, Leibniz Institute for Farm Animal Biology (FBN), Dummerstorf, GermanyThe complex and still poorly understood nature of thermoregulation in various fish species complicates the determination of the physiological status on the basis of diagnostic marker genes and indicative molecular pathways. The present study aimed to compare the physiological impacts of both gradual and acute temperature rise from 18 to 24°C on maraena whitefish in aquaculture. Microarray-based transcriptome profiles in the liver, spleen and kidney of heat-stressed maraena whitefish revealed the modulation of a significantly higher number of genes in those groups exposed to gradually rising temperatures compared with the acutely stressed groups, which might reflect early adaptation mechanisms. Moreover, we suggest a common set of 11 differentially expressed genes that indicate thermal stress induced by gradual or acute temperature rise in the three selected tissues. Besides the two pathways regulated in both data sets unfolded protein response and aldosterone signaling in epithelial cells, we identified unique tissue- and stress type-specific pathways reflecting the crossroads between signal transduction, metabolic and immunologic pathways to cope with thermal stress. In addition, comparing lists of differentially regulated genes with meta-analyzed published data sets revealed that “acute temperature rise”-responding genes that encode members of the HSP70, HSP90, and HSP40 families; their functional homologs; co-chaperones and stress-signal transducers are well-conserved across different species, tissues and/or cell types and experimental approaches.https://www.frontiersin.org/article/10.3389/fgene.2018.00241/fullaquacultureDE genessalmonid fishtranscriptometemperature challengewelfare |
| spellingShingle | Alexander Rebl Marieke Verleih Mareen Nipkow Simone Altmann Ralf Bochert Tom Goldammer Gradual and Acute Temperature Rise Induces Crossing Endocrine, Metabolic, and Immunological Pathways in Maraena Whitefish (Coregonus maraena) Frontiers in Genetics aquaculture DE genes salmonid fish transcriptome temperature challenge welfare |
| title | Gradual and Acute Temperature Rise Induces Crossing Endocrine, Metabolic, and Immunological Pathways in Maraena Whitefish (Coregonus maraena) |
| title_full | Gradual and Acute Temperature Rise Induces Crossing Endocrine, Metabolic, and Immunological Pathways in Maraena Whitefish (Coregonus maraena) |
| title_fullStr | Gradual and Acute Temperature Rise Induces Crossing Endocrine, Metabolic, and Immunological Pathways in Maraena Whitefish (Coregonus maraena) |
| title_full_unstemmed | Gradual and Acute Temperature Rise Induces Crossing Endocrine, Metabolic, and Immunological Pathways in Maraena Whitefish (Coregonus maraena) |
| title_short | Gradual and Acute Temperature Rise Induces Crossing Endocrine, Metabolic, and Immunological Pathways in Maraena Whitefish (Coregonus maraena) |
| title_sort | gradual and acute temperature rise induces crossing endocrine metabolic and immunological pathways in maraena whitefish coregonus maraena |
| topic | aquaculture DE genes salmonid fish transcriptome temperature challenge welfare |
| url | https://www.frontiersin.org/article/10.3389/fgene.2018.00241/full |
| work_keys_str_mv | AT alexanderrebl gradualandacutetemperatureriseinducescrossingendocrinemetabolicandimmunologicalpathwaysinmaraenawhitefishcoregonusmaraena AT mariekeverleih gradualandacutetemperatureriseinducescrossingendocrinemetabolicandimmunologicalpathwaysinmaraenawhitefishcoregonusmaraena AT mareennipkow gradualandacutetemperatureriseinducescrossingendocrinemetabolicandimmunologicalpathwaysinmaraenawhitefishcoregonusmaraena AT simonealtmann gradualandacutetemperatureriseinducescrossingendocrinemetabolicandimmunologicalpathwaysinmaraenawhitefishcoregonusmaraena AT ralfbochert gradualandacutetemperatureriseinducescrossingendocrinemetabolicandimmunologicalpathwaysinmaraenawhitefishcoregonusmaraena AT tomgoldammer gradualandacutetemperatureriseinducescrossingendocrinemetabolicandimmunologicalpathwaysinmaraenawhitefishcoregonusmaraena |