Validation of Candidate Phospholipid Biomarkers of Chronic Kidney Disease in Hyperglycemic Individuals and Their Organ-Specific Exploration in Leptin Receptor-Deficient db/db Mouse
Biological exploration of early biomarkers for chronic kidney disease (CKD) in (pre)diabetic individuals is crucial for personalized management of diabetes. Here, we evaluated two candidate biomarkers of incident CKD (sphingomyelin (SM) C18:1 and phosphatidylcholine diacyl (PC aa) C38:0) concerning...
Main Authors: | , , , , , , , , , , , , , , , , , , , |
---|---|
Format: | Article |
Language: | English |
Published: |
MDPI AG
2021-02-01
|
Series: | Metabolites |
Subjects: | |
Online Access: | https://www.mdpi.com/2218-1989/11/2/89 |
_version_ | 1827604241943887872 |
---|---|
author | Jialing Huang Marcela Covic Cornelia Huth Martina Rommel Jonathan Adam Sven Zukunft Cornelia Prehn Li Wang Jana Nano Markus F. Scheerer Susanne Neschen Gabi Kastenmüller Christian Gieger Michael Laxy Freimut Schliess Jerzy Adamski Karsten Suhre Martin Hrabe de Angelis Annette Peters Rui Wang-Sattler |
author_facet | Jialing Huang Marcela Covic Cornelia Huth Martina Rommel Jonathan Adam Sven Zukunft Cornelia Prehn Li Wang Jana Nano Markus F. Scheerer Susanne Neschen Gabi Kastenmüller Christian Gieger Michael Laxy Freimut Schliess Jerzy Adamski Karsten Suhre Martin Hrabe de Angelis Annette Peters Rui Wang-Sattler |
author_sort | Jialing Huang |
collection | DOAJ |
description | Biological exploration of early biomarkers for chronic kidney disease (CKD) in (pre)diabetic individuals is crucial for personalized management of diabetes. Here, we evaluated two candidate biomarkers of incident CKD (sphingomyelin (SM) C18:1 and phosphatidylcholine diacyl (PC aa) C38:0) concerning kidney function in hyperglycemic participants of the Cooperative Health Research in the Region of Augsburg (KORA) cohort, and in two biofluids and six organs of leptin receptor-deficient (db/db) mice and wild type controls. Higher serum concentrations of SM C18:1 and PC aa C38:0 in hyperglycemic individuals were found to be associated with lower estimated glomerular filtration rate (eGFR) and higher odds of CKD. In db/db mice, both metabolites had a significantly lower concentration in urine and adipose tissue, but higher in the lungs. Additionally, db/db mice had significantly higher SM C18:1 levels in plasma and liver, and PC aa C38:0 in adrenal glands. This cross-sectional human study confirms that SM C18:1 and PC aa C38:0 associate with kidney dysfunction in pre(diabetic) individuals, and the animal study suggests a potential implication of liver, lungs, adrenal glands, and visceral fat in their systemic regulation. Our results support further validation of the two phospholipids as early biomarkers of renal disease in patients with (pre)diabetes. |
first_indexed | 2024-03-09T05:56:15Z |
format | Article |
id | doaj.art-661cd130a4334bf6a5cdd3686c6d091f |
institution | Directory Open Access Journal |
issn | 2218-1989 |
language | English |
last_indexed | 2024-03-09T05:56:15Z |
publishDate | 2021-02-01 |
publisher | MDPI AG |
record_format | Article |
series | Metabolites |
spelling | doaj.art-661cd130a4334bf6a5cdd3686c6d091f2023-12-03T12:13:39ZengMDPI AGMetabolites2218-19892021-02-011128910.3390/metabo11020089Validation of Candidate Phospholipid Biomarkers of Chronic Kidney Disease in Hyperglycemic Individuals and Their Organ-Specific Exploration in Leptin Receptor-Deficient db/db MouseJialing Huang0Marcela Covic1Cornelia Huth2Martina Rommel3Jonathan Adam4Sven Zukunft5Cornelia Prehn6Li Wang7Jana Nano8Markus F. Scheerer9Susanne Neschen10Gabi Kastenmüller11Christian Gieger12Michael Laxy13Freimut Schliess14Jerzy Adamski15Karsten Suhre16Martin Hrabe de Angelis17Annette Peters18Rui Wang-Sattler19Research Unit of Molecular Epidemiology, Helmholtz Zentrum München, 85764 Neuherberg, GermanyResearch Unit of Molecular Epidemiology, Helmholtz Zentrum München, 85764 Neuherberg, GermanyInstitute of Epidemiology, Helmholtz Zentrum München, 85764 Neuherberg, GermanyResearch Unit of Molecular Epidemiology, Helmholtz Zentrum München, 85764 Neuherberg, GermanyResearch Unit of Molecular Epidemiology, Helmholtz Zentrum München, 85764 Neuherberg, GermanyResearch Unit of Molecular Endocrinology and Metabolism, Helmholtz Zentrum München, 85764 Neuherberg, GermanyMetabolomics and Proteomics Core Facility, Helmholtz Zentrum München, 85764 Neuherberg, GermanyResearch Unit of Molecular Epidemiology, Helmholtz Zentrum München, 85764 Neuherberg, GermanyInstitute of Epidemiology, Helmholtz Zentrum München, 85764 Neuherberg, GermanyInstitute of Experimental Genetics, Helmholtz Zentrum München, 85764 Neuherberg, GermanyInstitute of Experimental Genetics, Helmholtz Zentrum München, 85764 Neuherberg, GermanyInstitute of Computational Biology, Helmholtz Zentrum München, 85764 Neuherberg, GermanyResearch Unit of Molecular Epidemiology, Helmholtz Zentrum München, 85764 Neuherberg, GermanyInstitute of Health Economics and Health Care Management, Helmholtz Zentrum München, 85764 Neuherberg, GermanyProfil, 41460 Neuss, GermanyResearch Unit of Molecular Endocrinology and Metabolism, Helmholtz Zentrum München, 85764 Neuherberg, GermanyDepartment of Physiology and Biophysics, Weill Cornell Medical College in Qatar (WCMC-Q), Education City, Qatar Foundation, Doha P.O. Box 24144, QatarGerman Center for Diabetes Research (DZD), 85764 München-Neuherberg, GermanyInstitute of Epidemiology, Helmholtz Zentrum München, 85764 Neuherberg, GermanyResearch Unit of Molecular Epidemiology, Helmholtz Zentrum München, 85764 Neuherberg, GermanyBiological exploration of early biomarkers for chronic kidney disease (CKD) in (pre)diabetic individuals is crucial for personalized management of diabetes. Here, we evaluated two candidate biomarkers of incident CKD (sphingomyelin (SM) C18:1 and phosphatidylcholine diacyl (PC aa) C38:0) concerning kidney function in hyperglycemic participants of the Cooperative Health Research in the Region of Augsburg (KORA) cohort, and in two biofluids and six organs of leptin receptor-deficient (db/db) mice and wild type controls. Higher serum concentrations of SM C18:1 and PC aa C38:0 in hyperglycemic individuals were found to be associated with lower estimated glomerular filtration rate (eGFR) and higher odds of CKD. In db/db mice, both metabolites had a significantly lower concentration in urine and adipose tissue, but higher in the lungs. Additionally, db/db mice had significantly higher SM C18:1 levels in plasma and liver, and PC aa C38:0 in adrenal glands. This cross-sectional human study confirms that SM C18:1 and PC aa C38:0 associate with kidney dysfunction in pre(diabetic) individuals, and the animal study suggests a potential implication of liver, lungs, adrenal glands, and visceral fat in their systemic regulation. Our results support further validation of the two phospholipids as early biomarkers of renal disease in patients with (pre)diabetes.https://www.mdpi.com/2218-1989/11/2/89chronic kidney diseaseprediabetes and type 2 diabetesdiabetic nephropathyreduced kidney functionleptin receptor-deficient mousehigh-fat-diet |
spellingShingle | Jialing Huang Marcela Covic Cornelia Huth Martina Rommel Jonathan Adam Sven Zukunft Cornelia Prehn Li Wang Jana Nano Markus F. Scheerer Susanne Neschen Gabi Kastenmüller Christian Gieger Michael Laxy Freimut Schliess Jerzy Adamski Karsten Suhre Martin Hrabe de Angelis Annette Peters Rui Wang-Sattler Validation of Candidate Phospholipid Biomarkers of Chronic Kidney Disease in Hyperglycemic Individuals and Their Organ-Specific Exploration in Leptin Receptor-Deficient db/db Mouse Metabolites chronic kidney disease prediabetes and type 2 diabetes diabetic nephropathy reduced kidney function leptin receptor-deficient mouse high-fat-diet |
title | Validation of Candidate Phospholipid Biomarkers of Chronic Kidney Disease in Hyperglycemic Individuals and Their Organ-Specific Exploration in Leptin Receptor-Deficient db/db Mouse |
title_full | Validation of Candidate Phospholipid Biomarkers of Chronic Kidney Disease in Hyperglycemic Individuals and Their Organ-Specific Exploration in Leptin Receptor-Deficient db/db Mouse |
title_fullStr | Validation of Candidate Phospholipid Biomarkers of Chronic Kidney Disease in Hyperglycemic Individuals and Their Organ-Specific Exploration in Leptin Receptor-Deficient db/db Mouse |
title_full_unstemmed | Validation of Candidate Phospholipid Biomarkers of Chronic Kidney Disease in Hyperglycemic Individuals and Their Organ-Specific Exploration in Leptin Receptor-Deficient db/db Mouse |
title_short | Validation of Candidate Phospholipid Biomarkers of Chronic Kidney Disease in Hyperglycemic Individuals and Their Organ-Specific Exploration in Leptin Receptor-Deficient db/db Mouse |
title_sort | validation of candidate phospholipid biomarkers of chronic kidney disease in hyperglycemic individuals and their organ specific exploration in leptin receptor deficient db db mouse |
topic | chronic kidney disease prediabetes and type 2 diabetes diabetic nephropathy reduced kidney function leptin receptor-deficient mouse high-fat-diet |
url | https://www.mdpi.com/2218-1989/11/2/89 |
work_keys_str_mv | AT jialinghuang validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse AT marcelacovic validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse AT corneliahuth validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse AT martinarommel validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse AT jonathanadam validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse AT svenzukunft validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse AT corneliaprehn validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse AT liwang validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse AT jananano validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse AT markusfscheerer validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse AT susanneneschen validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse AT gabikastenmuller validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse AT christiangieger validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse AT michaellaxy validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse AT freimutschliess validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse AT jerzyadamski validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse AT karstensuhre validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse AT martinhrabedeangelis validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse AT annettepeters validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse AT ruiwangsattler validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse |