Validation of Candidate Phospholipid Biomarkers of Chronic Kidney Disease in Hyperglycemic Individuals and Their Organ-Specific Exploration in Leptin Receptor-Deficient db/db Mouse

Biological exploration of early biomarkers for chronic kidney disease (CKD) in (pre)diabetic individuals is crucial for personalized management of diabetes. Here, we evaluated two candidate biomarkers of incident CKD (sphingomyelin (SM) C18:1 and phosphatidylcholine diacyl (PC aa) C38:0) concerning...

Full description

Bibliographic Details
Main Authors: Jialing Huang, Marcela Covic, Cornelia Huth, Martina Rommel, Jonathan Adam, Sven Zukunft, Cornelia Prehn, Li Wang, Jana Nano, Markus F. Scheerer, Susanne Neschen, Gabi Kastenmüller, Christian Gieger, Michael Laxy, Freimut Schliess, Jerzy Adamski, Karsten Suhre, Martin Hrabe de Angelis, Annette Peters, Rui Wang-Sattler
Format: Article
Language:English
Published: MDPI AG 2021-02-01
Series:Metabolites
Subjects:
Online Access:https://www.mdpi.com/2218-1989/11/2/89
_version_ 1827604241943887872
author Jialing Huang
Marcela Covic
Cornelia Huth
Martina Rommel
Jonathan Adam
Sven Zukunft
Cornelia Prehn
Li Wang
Jana Nano
Markus F. Scheerer
Susanne Neschen
Gabi Kastenmüller
Christian Gieger
Michael Laxy
Freimut Schliess
Jerzy Adamski
Karsten Suhre
Martin Hrabe de Angelis
Annette Peters
Rui Wang-Sattler
author_facet Jialing Huang
Marcela Covic
Cornelia Huth
Martina Rommel
Jonathan Adam
Sven Zukunft
Cornelia Prehn
Li Wang
Jana Nano
Markus F. Scheerer
Susanne Neschen
Gabi Kastenmüller
Christian Gieger
Michael Laxy
Freimut Schliess
Jerzy Adamski
Karsten Suhre
Martin Hrabe de Angelis
Annette Peters
Rui Wang-Sattler
author_sort Jialing Huang
collection DOAJ
description Biological exploration of early biomarkers for chronic kidney disease (CKD) in (pre)diabetic individuals is crucial for personalized management of diabetes. Here, we evaluated two candidate biomarkers of incident CKD (sphingomyelin (SM) C18:1 and phosphatidylcholine diacyl (PC aa) C38:0) concerning kidney function in hyperglycemic participants of the Cooperative Health Research in the Region of Augsburg (KORA) cohort, and in two biofluids and six organs of leptin receptor-deficient (db/db) mice and wild type controls. Higher serum concentrations of SM C18:1 and PC aa C38:0 in hyperglycemic individuals were found to be associated with lower estimated glomerular filtration rate (eGFR) and higher odds of CKD. In db/db mice, both metabolites had a significantly lower concentration in urine and adipose tissue, but higher in the lungs. Additionally, db/db mice had significantly higher SM C18:1 levels in plasma and liver, and PC aa C38:0 in adrenal glands. This cross-sectional human study confirms that SM C18:1 and PC aa C38:0 associate with kidney dysfunction in pre(diabetic) individuals, and the animal study suggests a potential implication of liver, lungs, adrenal glands, and visceral fat in their systemic regulation. Our results support further validation of the two phospholipids as early biomarkers of renal disease in patients with (pre)diabetes.
first_indexed 2024-03-09T05:56:15Z
format Article
id doaj.art-661cd130a4334bf6a5cdd3686c6d091f
institution Directory Open Access Journal
issn 2218-1989
language English
last_indexed 2024-03-09T05:56:15Z
publishDate 2021-02-01
publisher MDPI AG
record_format Article
series Metabolites
spelling doaj.art-661cd130a4334bf6a5cdd3686c6d091f2023-12-03T12:13:39ZengMDPI AGMetabolites2218-19892021-02-011128910.3390/metabo11020089Validation of Candidate Phospholipid Biomarkers of Chronic Kidney Disease in Hyperglycemic Individuals and Their Organ-Specific Exploration in Leptin Receptor-Deficient db/db MouseJialing Huang0Marcela Covic1Cornelia Huth2Martina Rommel3Jonathan Adam4Sven Zukunft5Cornelia Prehn6Li Wang7Jana Nano8Markus F. Scheerer9Susanne Neschen10Gabi Kastenmüller11Christian Gieger12Michael Laxy13Freimut Schliess14Jerzy Adamski15Karsten Suhre16Martin Hrabe de Angelis17Annette Peters18Rui Wang-Sattler19Research Unit of Molecular Epidemiology, Helmholtz Zentrum München, 85764 Neuherberg, GermanyResearch Unit of Molecular Epidemiology, Helmholtz Zentrum München, 85764 Neuherberg, GermanyInstitute of Epidemiology, Helmholtz Zentrum München, 85764 Neuherberg, GermanyResearch Unit of Molecular Epidemiology, Helmholtz Zentrum München, 85764 Neuherberg, GermanyResearch Unit of Molecular Epidemiology, Helmholtz Zentrum München, 85764 Neuherberg, GermanyResearch Unit of Molecular Endocrinology and Metabolism, Helmholtz Zentrum München, 85764 Neuherberg, GermanyMetabolomics and Proteomics Core Facility, Helmholtz Zentrum München, 85764 Neuherberg, GermanyResearch Unit of Molecular Epidemiology, Helmholtz Zentrum München, 85764 Neuherberg, GermanyInstitute of Epidemiology, Helmholtz Zentrum München, 85764 Neuherberg, GermanyInstitute of Experimental Genetics, Helmholtz Zentrum München, 85764 Neuherberg, GermanyInstitute of Experimental Genetics, Helmholtz Zentrum München, 85764 Neuherberg, GermanyInstitute of Computational Biology, Helmholtz Zentrum München, 85764 Neuherberg, GermanyResearch Unit of Molecular Epidemiology, Helmholtz Zentrum München, 85764 Neuherberg, GermanyInstitute of Health Economics and Health Care Management, Helmholtz Zentrum München, 85764 Neuherberg, GermanyProfil, 41460 Neuss, GermanyResearch Unit of Molecular Endocrinology and Metabolism, Helmholtz Zentrum München, 85764 Neuherberg, GermanyDepartment of Physiology and Biophysics, Weill Cornell Medical College in Qatar (WCMC-Q), Education City, Qatar Foundation, Doha P.O. Box 24144, QatarGerman Center for Diabetes Research (DZD), 85764 München-Neuherberg, GermanyInstitute of Epidemiology, Helmholtz Zentrum München, 85764 Neuherberg, GermanyResearch Unit of Molecular Epidemiology, Helmholtz Zentrum München, 85764 Neuherberg, GermanyBiological exploration of early biomarkers for chronic kidney disease (CKD) in (pre)diabetic individuals is crucial for personalized management of diabetes. Here, we evaluated two candidate biomarkers of incident CKD (sphingomyelin (SM) C18:1 and phosphatidylcholine diacyl (PC aa) C38:0) concerning kidney function in hyperglycemic participants of the Cooperative Health Research in the Region of Augsburg (KORA) cohort, and in two biofluids and six organs of leptin receptor-deficient (db/db) mice and wild type controls. Higher serum concentrations of SM C18:1 and PC aa C38:0 in hyperglycemic individuals were found to be associated with lower estimated glomerular filtration rate (eGFR) and higher odds of CKD. In db/db mice, both metabolites had a significantly lower concentration in urine and adipose tissue, but higher in the lungs. Additionally, db/db mice had significantly higher SM C18:1 levels in plasma and liver, and PC aa C38:0 in adrenal glands. This cross-sectional human study confirms that SM C18:1 and PC aa C38:0 associate with kidney dysfunction in pre(diabetic) individuals, and the animal study suggests a potential implication of liver, lungs, adrenal glands, and visceral fat in their systemic regulation. Our results support further validation of the two phospholipids as early biomarkers of renal disease in patients with (pre)diabetes.https://www.mdpi.com/2218-1989/11/2/89chronic kidney diseaseprediabetes and type 2 diabetesdiabetic nephropathyreduced kidney functionleptin receptor-deficient mousehigh-fat-diet
spellingShingle Jialing Huang
Marcela Covic
Cornelia Huth
Martina Rommel
Jonathan Adam
Sven Zukunft
Cornelia Prehn
Li Wang
Jana Nano
Markus F. Scheerer
Susanne Neschen
Gabi Kastenmüller
Christian Gieger
Michael Laxy
Freimut Schliess
Jerzy Adamski
Karsten Suhre
Martin Hrabe de Angelis
Annette Peters
Rui Wang-Sattler
Validation of Candidate Phospholipid Biomarkers of Chronic Kidney Disease in Hyperglycemic Individuals and Their Organ-Specific Exploration in Leptin Receptor-Deficient db/db Mouse
Metabolites
chronic kidney disease
prediabetes and type 2 diabetes
diabetic nephropathy
reduced kidney function
leptin receptor-deficient mouse
high-fat-diet
title Validation of Candidate Phospholipid Biomarkers of Chronic Kidney Disease in Hyperglycemic Individuals and Their Organ-Specific Exploration in Leptin Receptor-Deficient db/db Mouse
title_full Validation of Candidate Phospholipid Biomarkers of Chronic Kidney Disease in Hyperglycemic Individuals and Their Organ-Specific Exploration in Leptin Receptor-Deficient db/db Mouse
title_fullStr Validation of Candidate Phospholipid Biomarkers of Chronic Kidney Disease in Hyperglycemic Individuals and Their Organ-Specific Exploration in Leptin Receptor-Deficient db/db Mouse
title_full_unstemmed Validation of Candidate Phospholipid Biomarkers of Chronic Kidney Disease in Hyperglycemic Individuals and Their Organ-Specific Exploration in Leptin Receptor-Deficient db/db Mouse
title_short Validation of Candidate Phospholipid Biomarkers of Chronic Kidney Disease in Hyperglycemic Individuals and Their Organ-Specific Exploration in Leptin Receptor-Deficient db/db Mouse
title_sort validation of candidate phospholipid biomarkers of chronic kidney disease in hyperglycemic individuals and their organ specific exploration in leptin receptor deficient db db mouse
topic chronic kidney disease
prediabetes and type 2 diabetes
diabetic nephropathy
reduced kidney function
leptin receptor-deficient mouse
high-fat-diet
url https://www.mdpi.com/2218-1989/11/2/89
work_keys_str_mv AT jialinghuang validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse
AT marcelacovic validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse
AT corneliahuth validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse
AT martinarommel validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse
AT jonathanadam validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse
AT svenzukunft validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse
AT corneliaprehn validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse
AT liwang validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse
AT jananano validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse
AT markusfscheerer validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse
AT susanneneschen validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse
AT gabikastenmuller validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse
AT christiangieger validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse
AT michaellaxy validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse
AT freimutschliess validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse
AT jerzyadamski validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse
AT karstensuhre validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse
AT martinhrabedeangelis validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse
AT annettepeters validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse
AT ruiwangsattler validationofcandidatephospholipidbiomarkersofchronickidneydiseaseinhyperglycemicindividualsandtheirorganspecificexplorationinleptinreceptordeficientdbdbmouse