Rooting and acclimatization of transgenic papaya plants var. Maradol roja
The disease caused by Papaya ringspot virus is the most important in papaya worldwide. The use of biotechnological techniques, as auxiliary tools, has facilitated the genetic improvement in papaya. Nevertheless, this species has a lot of constraints, mainly during rooting and acclimatization phases....
| Main Authors: | , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Universidad Central Marta Abreu de Las Villas
2008-01-01
|
| Series: | Biotecnología Vegetal |
| Online Access: | https://revista.ibp.co.cu/index.php/BV/article/view/333 |
| _version_ | 1828498012101410816 |
|---|---|
| author | Maylin Cruz Ana L. Darías Dariel Cabrera Amado Pérez Mileidy Cruz-Martín Tatiana Pichardo Rafael Gómez-Kosky Orelvis Portal |
| author_facet | Maylin Cruz Ana L. Darías Dariel Cabrera Amado Pérez Mileidy Cruz-Martín Tatiana Pichardo Rafael Gómez-Kosky Orelvis Portal |
| author_sort | Maylin Cruz |
| collection | DOAJ |
| description | The disease caused by Papaya ringspot virus is the most important in papaya worldwide. The use of biotechnological techniques, as auxiliary tools, has facilitated the genetic improvement in papaya. Nevertheless, this species has a lot of constraints, mainly during rooting and acclimatization phases. For that reason we developed the present work. The in vitro and ex vitro rooting was evaluated. Culture media with different concentrations of indol-3-butiric acid hormone were used in the in vitro rooting. The influence of Trichoderma harzianum bioproduct in the acclimatization of plants was also studied. The in vitro rooting of transgenic plants was achieved by applying 2 mg.l-1 of indol-3-butiric acid in the culture medium. The ex vitro rooting with high percentages of plants survival was also obtained. The applications of T. harzianum bioproduct on the substrate, previous to the plantation, demonstrated its stimulating effect.
Key words: Carica papaya, ex vitro, in vitro, Trichoderma harzianum |
| first_indexed | 2024-12-11T12:58:20Z |
| format | Article |
| id | doaj.art-6bf3439234d84cbf90fc762e41f351f5 |
| institution | Directory Open Access Journal |
| issn | 1609-1841 2074-8647 |
| language | English |
| last_indexed | 2024-12-11T12:58:20Z |
| publishDate | 2008-01-01 |
| publisher | Universidad Central Marta Abreu de Las Villas |
| record_format | Article |
| series | Biotecnología Vegetal |
| spelling | doaj.art-6bf3439234d84cbf90fc762e41f351f52022-12-22T01:06:31ZengUniversidad Central Marta Abreu de Las VillasBiotecnología Vegetal1609-18412074-86472008-01-0181307Rooting and acclimatization of transgenic papaya plants var. Maradol rojaMaylin CruzAna L. DaríasDariel CabreraAmado PérezMileidy Cruz-MartínTatiana PichardoRafael Gómez-KoskyOrelvis PortalThe disease caused by Papaya ringspot virus is the most important in papaya worldwide. The use of biotechnological techniques, as auxiliary tools, has facilitated the genetic improvement in papaya. Nevertheless, this species has a lot of constraints, mainly during rooting and acclimatization phases. For that reason we developed the present work. The in vitro and ex vitro rooting was evaluated. Culture media with different concentrations of indol-3-butiric acid hormone were used in the in vitro rooting. The influence of Trichoderma harzianum bioproduct in the acclimatization of plants was also studied. The in vitro rooting of transgenic plants was achieved by applying 2 mg.l-1 of indol-3-butiric acid in the culture medium. The ex vitro rooting with high percentages of plants survival was also obtained. The applications of T. harzianum bioproduct on the substrate, previous to the plantation, demonstrated its stimulating effect. Key words: Carica papaya, ex vitro, in vitro, Trichoderma harzianumhttps://revista.ibp.co.cu/index.php/BV/article/view/333 |
| spellingShingle | Maylin Cruz Ana L. Darías Dariel Cabrera Amado Pérez Mileidy Cruz-Martín Tatiana Pichardo Rafael Gómez-Kosky Orelvis Portal Rooting and acclimatization of transgenic papaya plants var. Maradol roja Biotecnología Vegetal |
| title | Rooting and acclimatization of transgenic papaya plants var. Maradol roja |
| title_full | Rooting and acclimatization of transgenic papaya plants var. Maradol roja |
| title_fullStr | Rooting and acclimatization of transgenic papaya plants var. Maradol roja |
| title_full_unstemmed | Rooting and acclimatization of transgenic papaya plants var. Maradol roja |
| title_short | Rooting and acclimatization of transgenic papaya plants var. Maradol roja |
| title_sort | rooting and acclimatization of transgenic papaya plants var maradol roja |
| url | https://revista.ibp.co.cu/index.php/BV/article/view/333 |
| work_keys_str_mv | AT maylincruz rootingandacclimatizationoftransgenicpapayaplantsvarmaradolroja AT analdarias rootingandacclimatizationoftransgenicpapayaplantsvarmaradolroja AT darielcabrera rootingandacclimatizationoftransgenicpapayaplantsvarmaradolroja AT amadoperez rootingandacclimatizationoftransgenicpapayaplantsvarmaradolroja AT mileidycruzmartin rootingandacclimatizationoftransgenicpapayaplantsvarmaradolroja AT tatianapichardo rootingandacclimatizationoftransgenicpapayaplantsvarmaradolroja AT rafaelgomezkosky rootingandacclimatizationoftransgenicpapayaplantsvarmaradolroja AT orelvisportal rootingandacclimatizationoftransgenicpapayaplantsvarmaradolroja |