The complete chloroplast genome of Tibetan folk medicinal plant Swertia franchetiana
Asone of the original plants of traditional Tibetan folk medicinal ‘Zangyinchen’, Swertia franchetiana (S. franchetiana) was used to treat a variety of ailments. Large amount of fruiting harvesting has led to a sharp decrease and gradual depletion of its resources. As a result, the wild resource is...
| Main Authors: | , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Taylor & Francis Group
2020-04-01
|
| Series: | Mitochondrial DNA. Part B. Resources |
| Subjects: | |
| Online Access: | http://dx.doi.org/10.1080/23802359.2020.1749149 |
| _version_ | 1797639291805892608 |
|---|---|
| author | Lucun Yang Feng Xiong Yuanming Xiao Jingjing Li Chen Chen Changbin Li Lingling Wang Guoying Zhou |
| author_facet | Lucun Yang Feng Xiong Yuanming Xiao Jingjing Li Chen Chen Changbin Li Lingling Wang Guoying Zhou |
| author_sort | Lucun Yang |
| collection | DOAJ |
| description | Asone of the original plants of traditional Tibetan folk medicinal ‘Zangyinchen’, Swertia franchetiana (S. franchetiana) was used to treat a variety of ailments. Large amount of fruiting harvesting has led to a sharp decrease and gradual depletion of its resources. As a result, the wild resource is on the verge of extinction, it needs urgent conservation. Here, we report the complete sequence of the chloroplast genome of S. franchetiana. The genome was 153,087 bp in length with 130 genes comprising 85 protein-coding genes, 37 tRNA genes, and 8 rRNA genes. The overall GC content of G. paludosa chloroplast genome was is 38.17%. Phylogenomic analysis suggested that S. franchetiana formed a clade with Swertia mussotii with high bootstrap values, indicating that the S. franchetiana was closely related to S. mussotii |
| first_indexed | 2024-03-11T13:14:42Z |
| format | Article |
| id | doaj.art-6c440e1226b342f1ac5ab804439a7406 |
| institution | Directory Open Access Journal |
| issn | 2380-2359 |
| language | English |
| last_indexed | 2024-03-11T13:14:42Z |
| publishDate | 2020-04-01 |
| publisher | Taylor & Francis Group |
| record_format | Article |
| series | Mitochondrial DNA. Part B. Resources |
| spelling | doaj.art-6c440e1226b342f1ac5ab804439a74062023-11-03T13:50:19ZengTaylor & Francis GroupMitochondrial DNA. Part B. Resources2380-23592020-04-01521781178210.1080/23802359.2020.17491491749149The complete chloroplast genome of Tibetan folk medicinal plant Swertia franchetianaLucun Yang0Feng Xiong1Yuanming Xiao2Jingjing Li3Chen Chen4Changbin Li5Lingling Wang6Guoying Zhou7Northwest Institute of Plateau Biology, Chinese Academy of SciencesNorthwest Institute of Plateau Biology, Chinese Academy of SciencesNorthwest Institute of Plateau Biology, Chinese Academy of SciencesQinghai Normal UniversityNorthwest Institute of Plateau Biology, Chinese Academy of SciencesNorthwest Institute of Plateau Biology, Chinese Academy of SciencesNorthwest Institute of Plateau Biology, Chinese Academy of SciencesNorthwest Institute of Plateau Biology, Chinese Academy of SciencesAsone of the original plants of traditional Tibetan folk medicinal ‘Zangyinchen’, Swertia franchetiana (S. franchetiana) was used to treat a variety of ailments. Large amount of fruiting harvesting has led to a sharp decrease and gradual depletion of its resources. As a result, the wild resource is on the verge of extinction, it needs urgent conservation. Here, we report the complete sequence of the chloroplast genome of S. franchetiana. The genome was 153,087 bp in length with 130 genes comprising 85 protein-coding genes, 37 tRNA genes, and 8 rRNA genes. The overall GC content of G. paludosa chloroplast genome was is 38.17%. Phylogenomic analysis suggested that S. franchetiana formed a clade with Swertia mussotii with high bootstrap values, indicating that the S. franchetiana was closely related to S. mussotiihttp://dx.doi.org/10.1080/23802359.2020.1749149swertia franchetianachloroplast genomegentianaceae |
| spellingShingle | Lucun Yang Feng Xiong Yuanming Xiao Jingjing Li Chen Chen Changbin Li Lingling Wang Guoying Zhou The complete chloroplast genome of Tibetan folk medicinal plant Swertia franchetiana Mitochondrial DNA. Part B. Resources swertia franchetiana chloroplast genome gentianaceae |
| title | The complete chloroplast genome of Tibetan folk medicinal plant Swertia franchetiana |
| title_full | The complete chloroplast genome of Tibetan folk medicinal plant Swertia franchetiana |
| title_fullStr | The complete chloroplast genome of Tibetan folk medicinal plant Swertia franchetiana |
| title_full_unstemmed | The complete chloroplast genome of Tibetan folk medicinal plant Swertia franchetiana |
| title_short | The complete chloroplast genome of Tibetan folk medicinal plant Swertia franchetiana |
| title_sort | complete chloroplast genome of tibetan folk medicinal plant swertia franchetiana |
| topic | swertia franchetiana chloroplast genome gentianaceae |
| url | http://dx.doi.org/10.1080/23802359.2020.1749149 |
| work_keys_str_mv | AT lucunyang thecompletechloroplastgenomeoftibetanfolkmedicinalplantswertiafranchetiana AT fengxiong thecompletechloroplastgenomeoftibetanfolkmedicinalplantswertiafranchetiana AT yuanmingxiao thecompletechloroplastgenomeoftibetanfolkmedicinalplantswertiafranchetiana AT jingjingli thecompletechloroplastgenomeoftibetanfolkmedicinalplantswertiafranchetiana AT chenchen thecompletechloroplastgenomeoftibetanfolkmedicinalplantswertiafranchetiana AT changbinli thecompletechloroplastgenomeoftibetanfolkmedicinalplantswertiafranchetiana AT linglingwang thecompletechloroplastgenomeoftibetanfolkmedicinalplantswertiafranchetiana AT guoyingzhou thecompletechloroplastgenomeoftibetanfolkmedicinalplantswertiafranchetiana AT lucunyang completechloroplastgenomeoftibetanfolkmedicinalplantswertiafranchetiana AT fengxiong completechloroplastgenomeoftibetanfolkmedicinalplantswertiafranchetiana AT yuanmingxiao completechloroplastgenomeoftibetanfolkmedicinalplantswertiafranchetiana AT jingjingli completechloroplastgenomeoftibetanfolkmedicinalplantswertiafranchetiana AT chenchen completechloroplastgenomeoftibetanfolkmedicinalplantswertiafranchetiana AT changbinli completechloroplastgenomeoftibetanfolkmedicinalplantswertiafranchetiana AT linglingwang completechloroplastgenomeoftibetanfolkmedicinalplantswertiafranchetiana AT guoyingzhou completechloroplastgenomeoftibetanfolkmedicinalplantswertiafranchetiana |