Intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells
Methods to monitor osmolarity-dependent changes in cell are currently lacking. Here the authors use the Arabidopsis intrinsically disordered AtLEA4-5 protein, which is expressed in plants under water deficit, to develop a FRET biosensor (SED1) to monitor osmotic stress.
| Main Authors: | , , , , , , , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Nature Portfolio
2021-09-01
|
| Series: | Nature Communications |
| Online Access: | https://doi.org/10.1038/s41467-021-25736-8 |
| _version_ | 1818401571225993216 |
|---|---|
| author | Cesar L. Cuevas-Velazquez Tamara Vellosillo Karina Guadalupe Hermann Broder Schmidt Feng Yu David Moses Jennifer A. N. Brophy Dante Cosio-Acosta Alakananda Das Lingxin Wang Alexander M. Jones Alejandra A. Covarrubias Shahar Sukenik José R. Dinneny |
| author_facet | Cesar L. Cuevas-Velazquez Tamara Vellosillo Karina Guadalupe Hermann Broder Schmidt Feng Yu David Moses Jennifer A. N. Brophy Dante Cosio-Acosta Alakananda Das Lingxin Wang Alexander M. Jones Alejandra A. Covarrubias Shahar Sukenik José R. Dinneny |
| author_sort | Cesar L. Cuevas-Velazquez |
| collection | DOAJ |
| description | Methods to monitor osmolarity-dependent changes in cell are currently lacking. Here the authors use the Arabidopsis intrinsically disordered AtLEA4-5 protein, which is expressed in plants under water deficit, to develop a FRET biosensor (SED1) to monitor osmotic stress. |
| first_indexed | 2024-12-14T07:54:35Z |
| format | Article |
| id | doaj.art-6c5fabb7d3ce4541b5c43c9f778914b1 |
| institution | Directory Open Access Journal |
| issn | 2041-1723 |
| language | English |
| last_indexed | 2024-12-14T07:54:35Z |
| publishDate | 2021-09-01 |
| publisher | Nature Portfolio |
| record_format | Article |
| series | Nature Communications |
| spelling | doaj.art-6c5fabb7d3ce4541b5c43c9f778914b12022-12-21T23:10:35ZengNature PortfolioNature Communications2041-17232021-09-0112111210.1038/s41467-021-25736-8Intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cellsCesar L. Cuevas-Velazquez0Tamara Vellosillo1Karina Guadalupe2Hermann Broder Schmidt3Feng Yu4David Moses5Jennifer A. N. Brophy6Dante Cosio-Acosta7Alakananda Das8Lingxin Wang9Alexander M. Jones10Alejandra A. Covarrubias11Shahar Sukenik12José R. Dinneny13Department of Biology, Stanford UniversityDepartment of Biology, Stanford UniversityCenter for Cellular and Biomolecular Machines (CCBM), University of CaliforniaDepartment of Biochemistry, Stanford University School of MedicineCenter for Cellular and Biomolecular Machines (CCBM), University of CaliforniaCenter for Cellular and Biomolecular Machines (CCBM), University of CaliforniaDepartment of Biology, Stanford UniversityDepartamento de Biología Molecular de Plantas, Instituto de Biotecnología, Universidad Nacional Autónoma de MéxicoDepartment of Molecular and Cellular Physiology, Stanford UniversityDepartment of Molecular and Cellular Physiology, Stanford UniversitySainsbury Laboratory, Cambridge UniversityDepartamento de Biología Molecular de Plantas, Instituto de Biotecnología, Universidad Nacional Autónoma de MéxicoCenter for Cellular and Biomolecular Machines (CCBM), University of CaliforniaDepartment of Biology, Stanford UniversityMethods to monitor osmolarity-dependent changes in cell are currently lacking. Here the authors use the Arabidopsis intrinsically disordered AtLEA4-5 protein, which is expressed in plants under water deficit, to develop a FRET biosensor (SED1) to monitor osmotic stress.https://doi.org/10.1038/s41467-021-25736-8 |
| spellingShingle | Cesar L. Cuevas-Velazquez Tamara Vellosillo Karina Guadalupe Hermann Broder Schmidt Feng Yu David Moses Jennifer A. N. Brophy Dante Cosio-Acosta Alakananda Das Lingxin Wang Alexander M. Jones Alejandra A. Covarrubias Shahar Sukenik José R. Dinneny Intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells Nature Communications |
| title | Intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells |
| title_full | Intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells |
| title_fullStr | Intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells |
| title_full_unstemmed | Intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells |
| title_short | Intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells |
| title_sort | intrinsically disordered protein biosensor tracks the physical chemical effects of osmotic stress on cells |
| url | https://doi.org/10.1038/s41467-021-25736-8 |
| work_keys_str_mv | AT cesarlcuevasvelazquez intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT tamaravellosillo intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT karinaguadalupe intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT hermannbroderschmidt intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT fengyu intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT davidmoses intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT jenniferanbrophy intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT dantecosioacosta intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT alakanandadas intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT lingxinwang intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT alexandermjones intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT alejandraacovarrubias intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT shaharsukenik intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT joserdinneny intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells |