Klasifikasi Motif Batik Berbasis Kemiripan Ciri dengan Wavelet Transform dan Fuzzy Neural Network
This paper introduces a classification of the image of the batik process, which is based on the similarity of the characteristics, by combining the method of wavelet transform Daubechies type 2 level 2, to process the characteristic texture consisting of standard deviation, mean and energy as input...
| Main Author: | |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Bina Nusantara University
2014-06-01
|
| Series: | ComTech |
| Subjects: | |
| Online Access: | https://journal.binus.ac.id/index.php/comtech/article/view/2630 |
| _version_ | 1797762728260009984 |
|---|---|
| author | A Haris Rangkuti |
| author_facet | A Haris Rangkuti |
| author_sort | A Haris Rangkuti |
| collection | DOAJ |
| description | This paper introduces a classification of the image of the batik process, which is based on the similarity of the characteristics, by combining the method of wavelet transform Daubechies type 2 level 2, to process the characteristic texture consisting of standard deviation, mean and energy as input variables, using the method of Fuzzy Neural Network (FNN). Fuzzyfikasi process will be carried out all input values with five categories: Very Low (VL), Low (L), Medium (M), High (H) and Very High (VH). The result will be a fuzzy input in the process of neural network classification methods. The result will be a fuzzy input in the process of neural network classification methods. For the image to be processed seven types of batik motif is ceplok, kawung, lereng, parang, megamendung, tambal and nitik. The results of the classification process with FNN is rule generation, so for the new image of batik can be immediately known motif types after treatment with FNN classification. For the degree of precision of this method is 86-92%. |
| first_indexed | 2024-03-12T19:32:33Z |
| format | Article |
| id | doaj.art-6d049a61612b4896a239ec6506b08c87 |
| institution | Directory Open Access Journal |
| issn | 2087-1244 2476-907X |
| language | English |
| last_indexed | 2024-03-12T19:32:33Z |
| publishDate | 2014-06-01 |
| publisher | Bina Nusantara University |
| record_format | Article |
| series | ComTech |
| spelling | doaj.art-6d049a61612b4896a239ec6506b08c872023-08-02T04:26:40ZengBina Nusantara UniversityComTech2087-12442476-907X2014-06-015136137210.21512/comtech.v5i1.26302030Klasifikasi Motif Batik Berbasis Kemiripan Ciri dengan Wavelet Transform dan Fuzzy Neural NetworkA Haris Rangkuti0Bina Nusantara UniversityThis paper introduces a classification of the image of the batik process, which is based on the similarity of the characteristics, by combining the method of wavelet transform Daubechies type 2 level 2, to process the characteristic texture consisting of standard deviation, mean and energy as input variables, using the method of Fuzzy Neural Network (FNN). Fuzzyfikasi process will be carried out all input values with five categories: Very Low (VL), Low (L), Medium (M), High (H) and Very High (VH). The result will be a fuzzy input in the process of neural network classification methods. The result will be a fuzzy input in the process of neural network classification methods. For the image to be processed seven types of batik motif is ceplok, kawung, lereng, parang, megamendung, tambal and nitik. The results of the classification process with FNN is rule generation, so for the new image of batik can be immediately known motif types after treatment with FNN classification. For the degree of precision of this method is 86-92%.https://journal.binus.ac.id/index.php/comtech/article/view/2630batik image, wavelet transform, daubechies, Fuzzy neural network, fuzzifikasi, rule generation, batik motif |
| spellingShingle | A Haris Rangkuti Klasifikasi Motif Batik Berbasis Kemiripan Ciri dengan Wavelet Transform dan Fuzzy Neural Network ComTech batik image, wavelet transform, daubechies, Fuzzy neural network, fuzzifikasi, rule generation, batik motif |
| title | Klasifikasi Motif Batik Berbasis Kemiripan Ciri dengan Wavelet Transform dan Fuzzy Neural Network |
| title_full | Klasifikasi Motif Batik Berbasis Kemiripan Ciri dengan Wavelet Transform dan Fuzzy Neural Network |
| title_fullStr | Klasifikasi Motif Batik Berbasis Kemiripan Ciri dengan Wavelet Transform dan Fuzzy Neural Network |
| title_full_unstemmed | Klasifikasi Motif Batik Berbasis Kemiripan Ciri dengan Wavelet Transform dan Fuzzy Neural Network |
| title_short | Klasifikasi Motif Batik Berbasis Kemiripan Ciri dengan Wavelet Transform dan Fuzzy Neural Network |
| title_sort | klasifikasi motif batik berbasis kemiripan ciri dengan wavelet transform dan fuzzy neural network |
| topic | batik image, wavelet transform, daubechies, Fuzzy neural network, fuzzifikasi, rule generation, batik motif |
| url | https://journal.binus.ac.id/index.php/comtech/article/view/2630 |
| work_keys_str_mv | AT aharisrangkuti klasifikasimotifbatikberbasiskemiripanciridenganwavelettransformdanfuzzyneuralnetwork |