Split Ring Resonator Inspired Dual-Band Monopole Antenna for ISM, WLAN, WIFI, and WiMAX Application
A dual-band antenna is used for several wireless networks like ISM, WLAN, WiMAX, and WiFi. The antenna's uppermost element is a monopole shape with a rectangular protrusion. Antennas are created in CST. Using a 19-millimetre-wide by 31-millimetre-long FR4 substrate, the antenna is created in a...
| Main Authors: | , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Faculty of Mechanical Engineering in Slavonski Brod, Faculty of Electrical Engineering in Osijek, Faculty of Civil Engineering in Osijek
2023-01-01
|
| Series: | Tehnički Vjesnik |
| Subjects: | |
| Online Access: | https://hrcak.srce.hr/file/444199 |
| _version_ | 1797206385006477312 |
|---|---|
| author | Roja Ganesan Maheswara Venkatesh Panchavarnam Jayasankar Thangaiyan |
| author_facet | Roja Ganesan Maheswara Venkatesh Panchavarnam Jayasankar Thangaiyan |
| author_sort | Roja Ganesan |
| collection | DOAJ |
| description | A dual-band antenna is used for several wireless networks like ISM, WLAN, WiMAX, and WiFi. The antenna's uppermost element is a monopole shape with a rectangular protrusion. Antennas are created in CST. Using a 19-millimetre-wide by 31-millimetre-long FR4 substrate, the antenna is created in a design environment. Due to the SRR printing in the ground and the antenna's defective ground structure, the antenna is able to achieve dual resonance. A split ring resonator printed at the base also helps achieve a second resonance. With the help of a parameter analysis, we can pick the optimal proportions for the design. The antenna resonates at both 2.3 and 5.8 GHz. We construct and test the antenna. The results obtained through simulation are equivalent to those obtained from measurements in terms of s11, gain, and directivity, as well as E-plane and H-plane patterns. Because of its compact size, consistent radiation pattern, dual-band use, and excellent impedance matching and bandwidth, the suggested antenna is an excellent choice for use in ISM networks and other wireless applications. |
| first_indexed | 2024-04-24T09:06:10Z |
| format | Article |
| id | doaj.art-6f5f0a78a5b94ca2a96bcb49d9ba8694 |
| institution | Directory Open Access Journal |
| issn | 1330-3651 1848-6339 |
| language | English |
| last_indexed | 2024-04-24T09:06:10Z |
| publishDate | 2023-01-01 |
| publisher | Faculty of Mechanical Engineering in Slavonski Brod, Faculty of Electrical Engineering in Osijek, Faculty of Civil Engineering in Osijek |
| record_format | Article |
| series | Tehnički Vjesnik |
| spelling | doaj.art-6f5f0a78a5b94ca2a96bcb49d9ba86942024-04-15T18:52:32ZengFaculty of Mechanical Engineering in Slavonski Brod, Faculty of Electrical Engineering in Osijek, Faculty of Civil Engineering in OsijekTehnički Vjesnik1330-36511848-63392023-01-013051533153810.17559/TV-20230210000344Split Ring Resonator Inspired Dual-Band Monopole Antenna for ISM, WLAN, WIFI, and WiMAX ApplicationRoja Ganesan0Maheswara Venkatesh Panchavarnam1Jayasankar Thangaiyan2Dept of Electronics and Communication Engineering, Periyar Centenary Polytechnic College, Vallam, ThanjavurDept of Electronics and Communication Engineering, University College of Engineering, BIT Campus, Anna University, TiruchirapalliDept of Electronics and Communication Engineering, University College of Engineering, BIT Campus, Anna University, TiruchirapalliA dual-band antenna is used for several wireless networks like ISM, WLAN, WiMAX, and WiFi. The antenna's uppermost element is a monopole shape with a rectangular protrusion. Antennas are created in CST. Using a 19-millimetre-wide by 31-millimetre-long FR4 substrate, the antenna is created in a design environment. Due to the SRR printing in the ground and the antenna's defective ground structure, the antenna is able to achieve dual resonance. A split ring resonator printed at the base also helps achieve a second resonance. With the help of a parameter analysis, we can pick the optimal proportions for the design. The antenna resonates at both 2.3 and 5.8 GHz. We construct and test the antenna. The results obtained through simulation are equivalent to those obtained from measurements in terms of s11, gain, and directivity, as well as E-plane and H-plane patterns. Because of its compact size, consistent radiation pattern, dual-band use, and excellent impedance matching and bandwidth, the suggested antenna is an excellent choice for use in ISM networks and other wireless applications.https://hrcak.srce.hr/file/444199dual-bandmetamaterialSRRWiMAXWLAN |
| spellingShingle | Roja Ganesan Maheswara Venkatesh Panchavarnam Jayasankar Thangaiyan Split Ring Resonator Inspired Dual-Band Monopole Antenna for ISM, WLAN, WIFI, and WiMAX Application Tehnički Vjesnik dual-band metamaterial SRR WiMAX WLAN |
| title | Split Ring Resonator Inspired Dual-Band Monopole Antenna for ISM, WLAN, WIFI, and WiMAX Application |
| title_full | Split Ring Resonator Inspired Dual-Band Monopole Antenna for ISM, WLAN, WIFI, and WiMAX Application |
| title_fullStr | Split Ring Resonator Inspired Dual-Band Monopole Antenna for ISM, WLAN, WIFI, and WiMAX Application |
| title_full_unstemmed | Split Ring Resonator Inspired Dual-Band Monopole Antenna for ISM, WLAN, WIFI, and WiMAX Application |
| title_short | Split Ring Resonator Inspired Dual-Band Monopole Antenna for ISM, WLAN, WIFI, and WiMAX Application |
| title_sort | split ring resonator inspired dual band monopole antenna for ism wlan wifi and wimax application |
| topic | dual-band metamaterial SRR WiMAX WLAN |
| url | https://hrcak.srce.hr/file/444199 |
| work_keys_str_mv | AT rojaganesan splitringresonatorinspireddualbandmonopoleantennaforismwlanwifiandwimaxapplication AT maheswaravenkateshpanchavarnam splitringresonatorinspireddualbandmonopoleantennaforismwlanwifiandwimaxapplication AT jayasankarthangaiyan splitringresonatorinspireddualbandmonopoleantennaforismwlanwifiandwimaxapplication |