Comparative analysis of programmed cell death pathways in filamentous fungi
<p>Abstract</p> <p>Background</p> <p>Fungi can undergo autophagic- or apoptotic-type programmed cell death (PCD) on exposure to antifungal agents, developmental signals, and stress factors. Filamentous fungi can also exhibit a form of cell death called heterokaryon inco...
| Main Authors: | , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
BMC
2005-12-01
|
| Series: | BMC Genomics |
| Online Access: | http://www.biomedcentral.com/1471-2164/6/177 |
| _version_ | 1828910542686781440 |
|---|---|
| author | Wortman Jennifer R Robson Geoff D Badger Jonathan H Fedorova Natalie D Nierman William C |
| author_facet | Wortman Jennifer R Robson Geoff D Badger Jonathan H Fedorova Natalie D Nierman William C |
| author_sort | Wortman Jennifer R |
| collection | DOAJ |
| description | <p>Abstract</p> <p>Background</p> <p>Fungi can undergo autophagic- or apoptotic-type programmed cell death (PCD) on exposure to antifungal agents, developmental signals, and stress factors. Filamentous fungi can also exhibit a form of cell death called heterokaryon incompatibility (HI) triggered by fusion between two genetically incompatible individuals. With the availability of recently sequenced genomes of <it>Aspergillus fumigatus </it>and several related species, we were able to define putative components of fungi-specific death pathways and the ancestral core apoptotic machinery shared by all fungi and metazoa.</p> <p>Results</p> <p>Phylogenetic profiling of HI-associated proteins from four Aspergilli and seven other fungal species revealed lineage-specific protein families, orphan genes, and core genes conserved across all fungi and metazoa. The Aspergilli-specific domain architectures include NACHT family NTPases, which may function as key integrators of stress and nutrient availability signals. They are often found fused to putative effector domains such as Pfs, SesB/LipA, and a newly identified domain, HET-s/LopB. Many putative HI inducers and mediators are specific to filamentous fungi and not found in unicellular yeasts. In addition to their role in HI, several of them appear to be involved in regulation of cell cycle, development and sexual differentiation. Finally, the Aspergilli possess many putative downstream components of the mammalian apoptotic machinery including several proteins not found in the model yeast, <it>Saccharomyces cerevisiae</it>.</p> <p>Conclusion</p> <p>Our analysis identified more than 100 putative PCD associated genes in the Aspergilli, which may help expand the range of currently available treatments for aspergillosis and other invasive fungal diseases. The list includes species-specific protein families as well as conserved core components of the ancestral PCD machinery shared by fungi and metazoa.</p> |
| first_indexed | 2024-12-13T18:45:53Z |
| format | Article |
| id | doaj.art-7397cd1ab34b4cdba40eb7bd338a36f3 |
| institution | Directory Open Access Journal |
| issn | 1471-2164 |
| language | English |
| last_indexed | 2024-12-13T18:45:53Z |
| publishDate | 2005-12-01 |
| publisher | BMC |
| record_format | Article |
| series | BMC Genomics |
| spelling | doaj.art-7397cd1ab34b4cdba40eb7bd338a36f32022-12-21T23:35:04ZengBMCBMC Genomics1471-21642005-12-016117710.1186/1471-2164-6-177Comparative analysis of programmed cell death pathways in filamentous fungiWortman Jennifer RRobson Geoff DBadger Jonathan HFedorova Natalie DNierman William C<p>Abstract</p> <p>Background</p> <p>Fungi can undergo autophagic- or apoptotic-type programmed cell death (PCD) on exposure to antifungal agents, developmental signals, and stress factors. Filamentous fungi can also exhibit a form of cell death called heterokaryon incompatibility (HI) triggered by fusion between two genetically incompatible individuals. With the availability of recently sequenced genomes of <it>Aspergillus fumigatus </it>and several related species, we were able to define putative components of fungi-specific death pathways and the ancestral core apoptotic machinery shared by all fungi and metazoa.</p> <p>Results</p> <p>Phylogenetic profiling of HI-associated proteins from four Aspergilli and seven other fungal species revealed lineage-specific protein families, orphan genes, and core genes conserved across all fungi and metazoa. The Aspergilli-specific domain architectures include NACHT family NTPases, which may function as key integrators of stress and nutrient availability signals. They are often found fused to putative effector domains such as Pfs, SesB/LipA, and a newly identified domain, HET-s/LopB. Many putative HI inducers and mediators are specific to filamentous fungi and not found in unicellular yeasts. In addition to their role in HI, several of them appear to be involved in regulation of cell cycle, development and sexual differentiation. Finally, the Aspergilli possess many putative downstream components of the mammalian apoptotic machinery including several proteins not found in the model yeast, <it>Saccharomyces cerevisiae</it>.</p> <p>Conclusion</p> <p>Our analysis identified more than 100 putative PCD associated genes in the Aspergilli, which may help expand the range of currently available treatments for aspergillosis and other invasive fungal diseases. The list includes species-specific protein families as well as conserved core components of the ancestral PCD machinery shared by fungi and metazoa.</p>http://www.biomedcentral.com/1471-2164/6/177 |
| spellingShingle | Wortman Jennifer R Robson Geoff D Badger Jonathan H Fedorova Natalie D Nierman William C Comparative analysis of programmed cell death pathways in filamentous fungi BMC Genomics |
| title | Comparative analysis of programmed cell death pathways in filamentous fungi |
| title_full | Comparative analysis of programmed cell death pathways in filamentous fungi |
| title_fullStr | Comparative analysis of programmed cell death pathways in filamentous fungi |
| title_full_unstemmed | Comparative analysis of programmed cell death pathways in filamentous fungi |
| title_short | Comparative analysis of programmed cell death pathways in filamentous fungi |
| title_sort | comparative analysis of programmed cell death pathways in filamentous fungi |
| url | http://www.biomedcentral.com/1471-2164/6/177 |
| work_keys_str_mv | AT wortmanjenniferr comparativeanalysisofprogrammedcelldeathpathwaysinfilamentousfungi AT robsongeoffd comparativeanalysisofprogrammedcelldeathpathwaysinfilamentousfungi AT badgerjonathanh comparativeanalysisofprogrammedcelldeathpathwaysinfilamentousfungi AT fedorovanatalied comparativeanalysisofprogrammedcelldeathpathwaysinfilamentousfungi AT niermanwilliamc comparativeanalysisofprogrammedcelldeathpathwaysinfilamentousfungi |