Expression of Genes Involved in Heavy Metal Trafficking in Plants Exposed to Salinity Stress and Elevated Cd Concentrations
Many areas intended for crop production suffer from the concomitant occurrence of heavy metal pollution and elevated salinity; therefore, halophytes seem to represent a promising perspective for the bioremediation of contaminated soils. In this study, the influence of Cd treatment (0.01–10.0 mM) and...
| Main Authors: | , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
MDPI AG
2020-04-01
|
| Series: | Plants |
| Subjects: | |
| Online Access: | https://www.mdpi.com/2223-7747/9/4/475 |
| _version_ | 1797571129529860096 |
|---|---|
| author | Michał Nosek Adriana Kaczmarczyk Roman J. Jędrzejczyk Paulina Supel Paweł Kaszycki Zbigniew Miszalski |
| author_facet | Michał Nosek Adriana Kaczmarczyk Roman J. Jędrzejczyk Paulina Supel Paweł Kaszycki Zbigniew Miszalski |
| author_sort | Michał Nosek |
| collection | DOAJ |
| description | Many areas intended for crop production suffer from the concomitant occurrence of heavy metal pollution and elevated salinity; therefore, halophytes seem to represent a promising perspective for the bioremediation of contaminated soils. In this study, the influence of Cd treatment (0.01–10.0 mM) and salinity stress (0.4 M NaCl) on the expression of genes involved in heavy metal uptake (<i>irt2</i>–iron-regulated protein 2, <i>zip4</i>–zinc-induced protein 4), vacuolar sequestration (<i>abcc2</i>–ATP-binding cassette 2, <i>cax4</i>–cation exchanger 2 <i>pcs1</i>–phytochelatin synthase 1) and translocation into aerial organs (<i>hma4</i>–heavy metal ATPase 4) were analyzed in a soil-grown semi-halophyte <i>Mesembryanthemum crystallinum</i>. The upregulation of <i>irt2</i> expression induced by salinity was additionally enhanced by Cd treatment. Such changes were not observed for <i>zip4</i>. Stressor-induced alterations in <i>abcc2</i>, <i>cax4</i>, <i>hma4</i> and <i>pcs1</i> expression were most pronounced in the root tissue, and the expression of <i>cax4</i>, <i>hma4</i> and <i>pcs1</i> was upregulated in response to salinity and Cd. However, the cumulative effect of both stressors, similar to the one described for <i>irt2</i>, was observed only in the case of <i>pcs1</i>. The importance of salt stress in the <i>irt2</i> expression regulation mechanism is proposed. To the best of our knowledge, this study is the first to report the combined effect of salinity and heavy metal stress on genes involved in heavy metal trafficking. |
| first_indexed | 2024-03-10T20:35:14Z |
| format | Article |
| id | doaj.art-742acac86c07458fb001131e25d4495a |
| institution | Directory Open Access Journal |
| issn | 2223-7747 |
| language | English |
| last_indexed | 2024-03-10T20:35:14Z |
| publishDate | 2020-04-01 |
| publisher | MDPI AG |
| record_format | Article |
| series | Plants |
| spelling | doaj.art-742acac86c07458fb001131e25d4495a2023-11-19T21:05:29ZengMDPI AGPlants2223-77472020-04-019447510.3390/plants9040475Expression of Genes Involved in Heavy Metal Trafficking in Plants Exposed to Salinity Stress and Elevated Cd ConcentrationsMichał Nosek0Adriana Kaczmarczyk1Roman J. Jędrzejczyk2Paulina Supel3Paweł Kaszycki4Zbigniew Miszalski5Institute of Biology, Pedagogical University, Podchorążych 2, 30-084 Kraków, PolandThe Franciszek Górski Institute of Plant Physiology Polish Academy of Sciences, Niezapominajek 21, 30-239 Kraków, PolandMałopolska Centre of Biotechnology, Jagiellonian University, Gronostajowa 7a, 30-387 Kraków, PolandDepartment of Plant Biology and Biotechnology, Faculty of Biotechnology and Horticulture, University of Agriculture in Krakow, al. 29 Listopada 54, 31-425 Kraków, PolandDepartment of Plant Biology and Biotechnology, Faculty of Biotechnology and Horticulture, University of Agriculture in Krakow, al. 29 Listopada 54, 31-425 Kraków, PolandThe Franciszek Górski Institute of Plant Physiology Polish Academy of Sciences, Niezapominajek 21, 30-239 Kraków, PolandMany areas intended for crop production suffer from the concomitant occurrence of heavy metal pollution and elevated salinity; therefore, halophytes seem to represent a promising perspective for the bioremediation of contaminated soils. In this study, the influence of Cd treatment (0.01–10.0 mM) and salinity stress (0.4 M NaCl) on the expression of genes involved in heavy metal uptake (<i>irt2</i>–iron-regulated protein 2, <i>zip4</i>–zinc-induced protein 4), vacuolar sequestration (<i>abcc2</i>–ATP-binding cassette 2, <i>cax4</i>–cation exchanger 2 <i>pcs1</i>–phytochelatin synthase 1) and translocation into aerial organs (<i>hma4</i>–heavy metal ATPase 4) were analyzed in a soil-grown semi-halophyte <i>Mesembryanthemum crystallinum</i>. The upregulation of <i>irt2</i> expression induced by salinity was additionally enhanced by Cd treatment. Such changes were not observed for <i>zip4</i>. Stressor-induced alterations in <i>abcc2</i>, <i>cax4</i>, <i>hma4</i> and <i>pcs1</i> expression were most pronounced in the root tissue, and the expression of <i>cax4</i>, <i>hma4</i> and <i>pcs1</i> was upregulated in response to salinity and Cd. However, the cumulative effect of both stressors, similar to the one described for <i>irt2</i>, was observed only in the case of <i>pcs1</i>. The importance of salt stress in the <i>irt2</i> expression regulation mechanism is proposed. To the best of our knowledge, this study is the first to report the combined effect of salinity and heavy metal stress on genes involved in heavy metal trafficking.https://www.mdpi.com/2223-7747/9/4/475heavy metal stressheavy metals transporters<i>Mesembryanthemum crystallinum</i>phytoremediationsemi-halophyte |
| spellingShingle | Michał Nosek Adriana Kaczmarczyk Roman J. Jędrzejczyk Paulina Supel Paweł Kaszycki Zbigniew Miszalski Expression of Genes Involved in Heavy Metal Trafficking in Plants Exposed to Salinity Stress and Elevated Cd Concentrations Plants heavy metal stress heavy metals transporters <i>Mesembryanthemum crystallinum</i> phytoremediation semi-halophyte |
| title | Expression of Genes Involved in Heavy Metal Trafficking in Plants Exposed to Salinity Stress and Elevated Cd Concentrations |
| title_full | Expression of Genes Involved in Heavy Metal Trafficking in Plants Exposed to Salinity Stress and Elevated Cd Concentrations |
| title_fullStr | Expression of Genes Involved in Heavy Metal Trafficking in Plants Exposed to Salinity Stress and Elevated Cd Concentrations |
| title_full_unstemmed | Expression of Genes Involved in Heavy Metal Trafficking in Plants Exposed to Salinity Stress and Elevated Cd Concentrations |
| title_short | Expression of Genes Involved in Heavy Metal Trafficking in Plants Exposed to Salinity Stress and Elevated Cd Concentrations |
| title_sort | expression of genes involved in heavy metal trafficking in plants exposed to salinity stress and elevated cd concentrations |
| topic | heavy metal stress heavy metals transporters <i>Mesembryanthemum crystallinum</i> phytoremediation semi-halophyte |
| url | https://www.mdpi.com/2223-7747/9/4/475 |
| work_keys_str_mv | AT michałnosek expressionofgenesinvolvedinheavymetaltraffickinginplantsexposedtosalinitystressandelevatedcdconcentrations AT adrianakaczmarczyk expressionofgenesinvolvedinheavymetaltraffickinginplantsexposedtosalinitystressandelevatedcdconcentrations AT romanjjedrzejczyk expressionofgenesinvolvedinheavymetaltraffickinginplantsexposedtosalinitystressandelevatedcdconcentrations AT paulinasupel expressionofgenesinvolvedinheavymetaltraffickinginplantsexposedtosalinitystressandelevatedcdconcentrations AT pawełkaszycki expressionofgenesinvolvedinheavymetaltraffickinginplantsexposedtosalinitystressandelevatedcdconcentrations AT zbigniewmiszalski expressionofgenesinvolvedinheavymetaltraffickinginplantsexposedtosalinitystressandelevatedcdconcentrations |