Applications of edge analytics: a systematic review
With the development and expansion of the Internet of Things, computing at the edge is becoming increasingly important, especially for applications where real-time response is important. In this paper, we made a systematic review of the literature on analytics at the edge. We extracted data from 40...
| Main Author: | |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Sciendo
2023-12-01
|
| Series: | Acta Universitatis Sapientiae: Informatica |
| Subjects: | |
| Online Access: | https://doi.org/10.2478/ausi-2023-0021 |
| _version_ | 1797387260739452928 |
|---|---|
| author | Andročec Darko |
| author_facet | Andročec Darko |
| author_sort | Andročec Darko |
| collection | DOAJ |
| description | With the development and expansion of the Internet of Things, computing at the edge is becoming increasingly important, especially for applications where real-time response is important. In this paper, we made a systematic review of the literature on analytics at the edge. We extracted data from 40 selected primary relevant studies from the complete set of 419 papers retrieved from scientific databases. In our analysis of the full text of every primary study we investigated: temporal distribution of primary studies, publication types, domain and application areas of the primary papers, used machine learning and deep learning methods. We also elaborated on the main themes of the primary studies and recommended some possible interesting future research possibilities. |
| first_indexed | 2024-03-08T22:21:35Z |
| format | Article |
| id | doaj.art-792e6082bbc84669a45b837b01bc3f09 |
| institution | Directory Open Access Journal |
| issn | 2066-7760 |
| language | English |
| last_indexed | 2024-03-08T22:21:35Z |
| publishDate | 2023-12-01 |
| publisher | Sciendo |
| record_format | Article |
| series | Acta Universitatis Sapientiae: Informatica |
| spelling | doaj.art-792e6082bbc84669a45b837b01bc3f092023-12-18T12:44:44ZengSciendoActa Universitatis Sapientiae: Informatica2066-77602023-12-0115234535810.2478/ausi-2023-0021Applications of edge analytics: a systematic reviewAndročec Darko01Faculty of Organization and Informatics, University of Zagreb, Pavlinska 2, 42000Varaždin, CroatiaWith the development and expansion of the Internet of Things, computing at the edge is becoming increasingly important, especially for applications where real-time response is important. In this paper, we made a systematic review of the literature on analytics at the edge. We extracted data from 40 selected primary relevant studies from the complete set of 419 papers retrieved from scientific databases. In our analysis of the full text of every primary study we investigated: temporal distribution of primary studies, publication types, domain and application areas of the primary papers, used machine learning and deep learning methods. We also elaborated on the main themes of the primary studies and recommended some possible interesting future research possibilities.https://doi.org/10.2478/ausi-2023-0021machine learningtoxic commentdeep learningsystematic review |
| spellingShingle | Andročec Darko Applications of edge analytics: a systematic review Acta Universitatis Sapientiae: Informatica machine learning toxic comment deep learning systematic review |
| title | Applications of edge analytics: a systematic review |
| title_full | Applications of edge analytics: a systematic review |
| title_fullStr | Applications of edge analytics: a systematic review |
| title_full_unstemmed | Applications of edge analytics: a systematic review |
| title_short | Applications of edge analytics: a systematic review |
| title_sort | applications of edge analytics a systematic review |
| topic | machine learning toxic comment deep learning systematic review |
| url | https://doi.org/10.2478/ausi-2023-0021 |
| work_keys_str_mv | AT androcecdarko applicationsofedgeanalyticsasystematicreview |