Manipulating atmospheric CO2 concentration induces shifts in wheat leaf and spike microbiomes and in Fusarium pathogen communities
Changing atmospheric composition represents a source of uncertainty in our assessment of future disease risks, particularly in the context of mycotoxin producing fungal pathogens which are predicted to be more problematic with climate change. To address this uncertainty, we profiled microbiomes asso...
| Main Authors: | , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Frontiers Media S.A.
2023-10-01
|
| Series: | Frontiers in Microbiology |
| Subjects: | |
| Online Access: | https://www.frontiersin.org/articles/10.3389/fmicb.2023.1271219/full |
| _version_ | 1797662934360391680 |
|---|---|
| author | Matthew G. Bakker Briana K. Whitaker Susan P. McCormick Elizabeth A. Ainsworth Martha M. Vaughan |
| author_facet | Matthew G. Bakker Briana K. Whitaker Susan P. McCormick Elizabeth A. Ainsworth Martha M. Vaughan |
| author_sort | Matthew G. Bakker |
| collection | DOAJ |
| description | Changing atmospheric composition represents a source of uncertainty in our assessment of future disease risks, particularly in the context of mycotoxin producing fungal pathogens which are predicted to be more problematic with climate change. To address this uncertainty, we profiled microbiomes associated with wheat plants grown under ambient vs. elevated atmospheric carbon dioxide concentration [CO2] in a field setting over 2 years. We also compared the dynamics of naturally infecting versus artificially introduced Fusarium spp. We found that the well-known temporal dynamics of plant-associated microbiomes were affected by [CO2]. The abundances of many amplicon sequence variants significantly differed in response to [CO2], often in an interactive manner with date of sample collection or with tissue type. In addition, we found evidence that two strains within Fusarium – an important group of mycotoxin producing fungal pathogens of plants – responded to changes in [CO2]. The two sequence variants mapped to different phylogenetic subgroups within the genus Fusarium, and had differential [CO2] responses. This work informs our understanding of how plant-associated microbiomes and pathogens may respond to changing atmospheric compositions. |
| first_indexed | 2024-03-11T19:07:17Z |
| format | Article |
| id | doaj.art-7b1f87cab1a64d56aabc6e0536c4248e |
| institution | Directory Open Access Journal |
| issn | 1664-302X |
| language | English |
| last_indexed | 2024-03-11T19:07:17Z |
| publishDate | 2023-10-01 |
| publisher | Frontiers Media S.A. |
| record_format | Article |
| series | Frontiers in Microbiology |
| spelling | doaj.art-7b1f87cab1a64d56aabc6e0536c4248e2023-10-10T06:13:53ZengFrontiers Media S.A.Frontiers in Microbiology1664-302X2023-10-011410.3389/fmicb.2023.12712191271219Manipulating atmospheric CO2 concentration induces shifts in wheat leaf and spike microbiomes and in Fusarium pathogen communitiesMatthew G. Bakker0Briana K. Whitaker1Susan P. McCormick2Elizabeth A. Ainsworth3Martha M. Vaughan4Department of Microbiology, University of Manitoba, Winnipeg, MB, CanadaMycotoxin Prevention and Applied Microbiology Research Unit, National Center for Agricultural Utilization Research, Agricultural Research Service, United States Department of Agriculture, Peoria, IL, United StatesMycotoxin Prevention and Applied Microbiology Research Unit, National Center for Agricultural Utilization Research, Agricultural Research Service, United States Department of Agriculture, Peoria, IL, United StatesGlobal Change and Photosynthesis Research Unit, Agricultural Research Service, United States Department of Agriculture, Urbana, IL, United StatesMycotoxin Prevention and Applied Microbiology Research Unit, National Center for Agricultural Utilization Research, Agricultural Research Service, United States Department of Agriculture, Peoria, IL, United StatesChanging atmospheric composition represents a source of uncertainty in our assessment of future disease risks, particularly in the context of mycotoxin producing fungal pathogens which are predicted to be more problematic with climate change. To address this uncertainty, we profiled microbiomes associated with wheat plants grown under ambient vs. elevated atmospheric carbon dioxide concentration [CO2] in a field setting over 2 years. We also compared the dynamics of naturally infecting versus artificially introduced Fusarium spp. We found that the well-known temporal dynamics of plant-associated microbiomes were affected by [CO2]. The abundances of many amplicon sequence variants significantly differed in response to [CO2], often in an interactive manner with date of sample collection or with tissue type. In addition, we found evidence that two strains within Fusarium – an important group of mycotoxin producing fungal pathogens of plants – responded to changes in [CO2]. The two sequence variants mapped to different phylogenetic subgroups within the genus Fusarium, and had differential [CO2] responses. This work informs our understanding of how plant-associated microbiomes and pathogens may respond to changing atmospheric compositions.https://www.frontiersin.org/articles/10.3389/fmicb.2023.1271219/fullFusariummycotoxinwheatmicrobiomeFACEglobal change |
| spellingShingle | Matthew G. Bakker Briana K. Whitaker Susan P. McCormick Elizabeth A. Ainsworth Martha M. Vaughan Manipulating atmospheric CO2 concentration induces shifts in wheat leaf and spike microbiomes and in Fusarium pathogen communities Frontiers in Microbiology Fusarium mycotoxin wheat microbiome FACE global change |
| title | Manipulating atmospheric CO2 concentration induces shifts in wheat leaf and spike microbiomes and in Fusarium pathogen communities |
| title_full | Manipulating atmospheric CO2 concentration induces shifts in wheat leaf and spike microbiomes and in Fusarium pathogen communities |
| title_fullStr | Manipulating atmospheric CO2 concentration induces shifts in wheat leaf and spike microbiomes and in Fusarium pathogen communities |
| title_full_unstemmed | Manipulating atmospheric CO2 concentration induces shifts in wheat leaf and spike microbiomes and in Fusarium pathogen communities |
| title_short | Manipulating atmospheric CO2 concentration induces shifts in wheat leaf and spike microbiomes and in Fusarium pathogen communities |
| title_sort | manipulating atmospheric co2 concentration induces shifts in wheat leaf and spike microbiomes and in fusarium pathogen communities |
| topic | Fusarium mycotoxin wheat microbiome FACE global change |
| url | https://www.frontiersin.org/articles/10.3389/fmicb.2023.1271219/full |
| work_keys_str_mv | AT matthewgbakker manipulatingatmosphericco2concentrationinducesshiftsinwheatleafandspikemicrobiomesandinfusariumpathogencommunities AT brianakwhitaker manipulatingatmosphericco2concentrationinducesshiftsinwheatleafandspikemicrobiomesandinfusariumpathogencommunities AT susanpmccormick manipulatingatmosphericco2concentrationinducesshiftsinwheatleafandspikemicrobiomesandinfusariumpathogencommunities AT elizabethaainsworth manipulatingatmosphericco2concentrationinducesshiftsinwheatleafandspikemicrobiomesandinfusariumpathogencommunities AT marthamvaughan manipulatingatmosphericco2concentrationinducesshiftsinwheatleafandspikemicrobiomesandinfusariumpathogencommunities |